<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32206
Description |
Uncharacterized protein |
Sequence | MQQFQQFQQQQHFIQQQQYQQQQQQQQRLLQSPPLPQPQQSLQSPPPQQTVVHTPQSMMHTPQQQQQLVQTPQQHQSLASHFHLYPMVEKLTDAIENGTRDQNSDALVTELNSHFEKCQQLLNSISGSLGSKTMTVDGQKRNVEESEQLLQQRRDLIVEYRKSIEDIVKIEP |
Length | 172 |
Position | Middle |
Organism | Capsella rubella |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Capsella.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -1.052 |
Instability index | 87.46 |
Isoelectric point | 5.93 |
Molecular weight | 20089.15 |
Publications | PubMed=23749190
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP32206
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.61| 18| 52| 8| 29| 2
---------------------------------------------------------------------------
2- 19 (34.67/ 6.18) QQFQQFQQQQHFIQQQQY
24- 41 (33.94/12.47) QQQQRLLQSPPLPQPQQS
---------------------------------------------------------------------------
|