<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32203

Description Uncharacterized protein
SequenceMWLPKAEATNNKGTRSGSVAIAIDKDKSSQNAIKWTLENLASRGQTLALIHVLPKSQSSLDIEEGISHKQQMEKQTKDLFVSFHCYCSRKEIHCLDVVLEDVDKVKAIVEYVTVSAIENLVLGAPSRNSFMRRFKTDLPTSVSKAAPDFCNVYVISKGKISSVRNSSRPAPYHPSVLNEPSETHHDTIAIERKHKPANTPAVPRGRRSVDSDVTRLGLPKPPHGHMKLVGDFSDSESEFSYISASQQESDISFISSGRPSVDRSSFTYDLPESARTSRMSTSSDQSIGSHRLGIKFTDMSYLNGSSTVSDDSGRTSCSYSSQSLDDVEAQMRRLRLELKQTMDMYSSACREALTARHEATELQKLRTEEERRLEELKMTEETAMSMVEKERAKAKTALEAAEAANRLAEAEANRRLNAEMKVLKESDSFSRHSIVRYRKYSVQEIEEGTNNFAESRKVGEGGYGPVFRGHLDHTSVAVKVLRPDAAQGRSQFHKEVEVLSCIRHPNMVLLLGACPEYGILVYEYMAKGSLDDRLFRRGNTPPISWQLRFRIAAEIATGLLFLHQTKPEPIVHRDLKPGNVLLDHNYVSKISDVGLARLVPAVAENVTQYRVTSAAGTFCYIDPEYQQTGMLGVKSDVYSLGIMLLQLLTAKQPMGLAYYVEQAIEEGTLKDMLDPAVPDWPVEEALALAKLSLQCAELRRKDRPDLGKEVMPELNRLRELGEESLESVYYAGKGRSSHASQISYTSVRRFYSKTLPSA
Length758
PositionTail
OrganismCapsella rubella
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Brassicales> Brassicaceae> Camelineae> Capsella.
Aromaticity0.06
Grand average of hydropathy-0.474
Instability index53.09
Isoelectric point7.32
Molecular weight84642.92
Publications
PubMed=23749190

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP32203
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     141.14|      46|     293|     326|     434|       1
---------------------------------------------------------------------------
  387-  433 (67.13/114.97)	VEKERAKAKTALEAAEaANRLAEAEANRRLNAEMKVLKESDSFSRHS
  682-  727 (74.01/24.01)	VEEALALAKLSLQCAE.LRRKDRPDLGKEVMPELNRLRELGEESLES
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     114.78|      25|     351|     266|     294|       2
---------------------------------------------------------------------------
  200-  218 (27.88/13.69)	.....PAVPR.GRRSVDSD....VTRLGL
  266-  294 (39.78/31.87)	FTYDLPESARTSRMSTSSDqsigSHRLGI
  618-  642 (47.13/27.80)	FCYIDPEYQQTGMLGVKSD....VYSLGI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.30|      23|     144|     324|     357|       3
---------------------------------------------------------------------------
   61-   85 (33.86/14.31)	DIEEGIsHKQQME.KQTKDLFVSfHC
  326-  349 (37.44/36.64)	DVEAQM.RRLRLElKQTMDMYSS.AC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.55|      17|     293|     133|     176|       5
---------------------------------------------------------------------------
  114-  130 (27.88/61.79)	VSAIENLVLGAPSRNSF
  160-  176 (30.67/ 6.12)	ISSVRNSSRPAPYHPSV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.90|      10|     217|     440|     449|       7
---------------------------------------------------------------------------
  440-  449 (19.03/13.71)	YSVQEIEEGT
  659-  668 (18.87/13.53)	YVEQAIEEGT
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32203 with Med32 domain of Kingdom Viridiplantae
Unable to open file!