<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32166
| Description |
Mediator of RNA polymerase II transcription subunit |
| Sequence | MQKPQSHTTQQQQSVQTPLQHQTLASHLYPLVENLKDVTESRARDQNSDALYVDVQKQNLEESEQLLQQRMELIEEYKKSVEEIVKKEP |
| Length | 89 |
| Position | Middle |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Brassicales> Brassicaceae> Camelineae> Arabidopsis.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.120 |
| Instability index | 66.93 |
| Isoelectric point | 5.10 |
| Molecular weight | 10460.52 |
| Publications | PubMed=11130712
PubMed=27862469
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32166
No repeats found
No repeats found
|