<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32163
Description |
TFIIS elongation factor |
Sequence | MSSTGDEIIRIAKKMDRMVQKKNTVGALDLLKELKNLPMTLELLQSTRIGMSVNAIRKQSGEEDVTSLAKALIKSWKKLLDGPSADMEEKKKDQPAPAQNSPEPKEENSSSTNFAAQKDEFPAPSDGFITSFPKAPITSDSVRIKCRELLAAALKTGDDHIAIGANVDELGAQIEDAVFQEFKNTEAKYKNRIRSRIANLKDAKNPNLRRNVLCGNIAPDFFARMTAEEMASDELKEMRKNLTKEAIREHQMAKTGGTETDLFSCGKCKKKNCTYTQVQTRSADEPMTTFVFCNECGNRWKFC |
Length | 303 |
Position | Unknown |
Organism | Xenopus laevis (African clawed frog) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Amphibia>
Batrachia> Anura> Pipoidea> Pipidae> Xenopodinae> Xenopus> Xenopus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.657 |
Instability index | 46.91 |
Isoelectric point | 8.66 |
Molecular weight | 33809.28 |
Publications | PubMed=8836176
PubMed=27762356
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
zinc ion binding GO:0008270 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32163
No repeats found
|