<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32161
Description |
Putative RNA polymerase II complex component SRB7 |
Sequence | MDIITQLQDQLDEMAVLAVNTFGTLQRDAPPDRLSNSYPDPLNPNPKPEDVSTKPQVQGQPGAPPPAQAQPPAPDLSEQPKAMSHALVLAAKKFDALVAALPLSSEEDQVKRIQELQAENEVVGLELQKQLEAAERELKQVEVLFNEATDNCINFKRLD |
Length | 159 |
Position | Middle |
Organism | Sorghum bicolor (Sorghum) (Sorghum vulgare) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Sorghinae> Sorghum.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.546 |
Instability index | 50.85 |
Isoelectric point | 4.45 |
Molecular weight | 17456.46 |
Publications | PubMed=15466289
PubMed=15466290
PubMed=19189423
PubMed=29161754
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP32161
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.92| 21| 32| 26| 47| 1
---------------------------------------------------------------------------
26- 47 (37.22/20.01) QRDAPPDRLSNSyPDP.LNPNPK
60- 81 (37.70/16.13) QPGAPPPAQAQP.PAPdLSEQPK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.02| 17| 25| 103| 119| 2
---------------------------------------------------------------------------
103- 119 (26.19/16.46) LSSEEDQVKRIQELQAE
131- 147 (25.83/16.15) LEAAERELKQVEVLFNE
---------------------------------------------------------------------------
|