<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32150
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEEAEARPAPPDPNDARQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPASKEVAHRQQYFFWKNYRNNRLKHILPRPPPEPTPTPAPAPAAVPPSASVPSTVVPPVAAPPSALLPMSAAGASAMSPMQFAGTPGTNIPKNDMRNVMGGQGGRKRKIG |
| Length | 202 |
| Position | Middle |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.471 |
| Instability index | 57.37 |
| Isoelectric point | 9.46 |
| Molecular weight | 22795.01 |
| Publications | PubMed=16100779
PubMed=23299411
PubMed=24280374
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP32150
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.78| 19| 19| 122| 140| 1
---------------------------------------------------------------------------
122- 140 (38.68/14.35) PPPEPTPTPAPAPAAVPPS
144- 162 (35.10/12.48) PSTVVPPVAAPPSALLPMS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.80| 24| 27| 16| 39| 2
---------------------------------------------------------------------------
16- 39 (44.32/30.32) ARQRFLLELEFIQCL......ANPTYIHYL
40- 69 (38.48/25.49) AQNRYFEDEAFIGYLkylkywQRPEYIKYI
---------------------------------------------------------------------------
|