| Description | Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEEAEARPAPPDPNDARQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPASKEVAHRQQYFFWKNYRNNRLKHILPRPPPEPTPTPAPAPAAVPPSASVPSTVVPPVAAPPSALLPMSAAGASAMSPMQFAGTPGTNIPKNDMRNVMGGQGGRKRKIG |
| Length | 202 |
| Position | Middle |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa. |
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.471 |
| Instability index | 57.37 |
| Isoelectric point | 9.46 |
| Molecular weight | 22795.01 |
| Publications | PubMed=16100779 PubMed=23299411 PubMed=24280374 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
| Binary Interactions |
| Repeats |
>MDP32150
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.78| 19| 19| 122| 140| 1
---------------------------------------------------------------------------
122- 140 (38.68/14.35) PPPEPTPTPAPAPAAVPPS
144- 162 (35.10/12.48) PSTVVPPVAAPPSALLPMS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.80| 24| 27| 16| 39| 2
---------------------------------------------------------------------------
16- 39 (44.32/30.32) ARQRFLLELEFIQCL......ANPTYIHYL
40- 69 (38.48/25.49) AQNRYFEDEAFIGYLkylkywQRPEYIKYI
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) FWKNYRNNRL 2) GRKRKIG | 106 196 | 115 202 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab