Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MEEAEARPAPPDPNDARQRFLLELEFIQCLANPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKYIMYPHCLFFLELLQNANFRNAMAHPASKEVAHRQQYFFWKNYRNNRLKHILPRPPPEPTPTPAPAPAAVPPSASVPSTVVPPVAAPPSALLPMSAAGASAMSPMQFAGTPGTNIPKNDMRNVMGGQGGRKRKIG |
Length | 202 |
Position | Middle |
Organism | Oryza sativa subsp. japonica (Rice) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa. |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.471 |
Instability index | 57.37 |
Isoelectric point | 9.46 |
Molecular weight | 22795.01 |
Publications | PubMed=16100779 PubMed=23299411 PubMed=24280374 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP32150 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 73.78| 19| 19| 122| 140| 1 --------------------------------------------------------------------------- 122- 140 (38.68/14.35) PPPEPTPTPAPAPAAVPPS 144- 162 (35.10/12.48) PSTVVPPVAAPPSALLPMS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 82.80| 24| 27| 16| 39| 2 --------------------------------------------------------------------------- 16- 39 (44.32/30.32) ARQRFLLELEFIQCL......ANPTYIHYL 40- 69 (38.48/25.49) AQNRYFEDEAFIGYLkylkywQRPEYIKYI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FWKNYRNNRL 2) GRKRKIG | 106 196 | 115 202 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab