<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32145
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MPLAFYGTTNNDTGTLHFQYLEVIIRTMDSPLNLRPRPPNSRGPQTIADFIRRVNAEPGGFRALNEEEVRRNVIAERNGLHHEDVEMVTDQEADDDSKKPDIIAARHNIIMSLGQAIQISSNFLDFISLLLSKEIPTQAAVSISPWLRSQVPIGSIGATQLDAPTPLTQSRVADNKLITIGKRLVALNEAADTALAAANRLRQEINSETKYWQEVLTVSQKGWSTARLPQEPHDMGVKFGFSNAAPLFKNNSVAPLKRAEDGSVRLEYGRMGSKSERLQATLLHNGEVVGRSSLPRPLPDDAPLDDRVKEARNTIFAQELWHEINREGRTLHGHHVRLEQSAVTCALDPNRTISFELVGLDDQDHSRAPLPGDLDAETASITLHLLLSNAHRQNQLKRSERTAANAMRGPPPPYNLLLPIITYYRHEKTLEDCTTFLAAFCGALRSAGIQSSFSMTESINKGPPTAPPSEALMKTLLHPSEVQFDLTITPASRVRILAKPTPVFGTRFSIYLLHPQSNHLTSSFPPNQTDSVYENIKELVRYLSNAVPRALTMYYYPLVQEMRNSGNKGNNGETPNPPAPNTTTWIIHPDDLGLVDDDTETFGVRFAFTSNYTRGDEVGDAAKEPELRVTGDYMEDGKRVQHEWKWTASGPAGTQSGGSLDEIVKHILANGPSSSVLSA |
| Length | 679 |
| Position | Head |
| Organism | Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Sordariaceae> Neurospora.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.459 |
| Instability index | 45.96 |
| Isoelectric point | 5.95 |
| Molecular weight | 75064.52 |
| Publications | PubMed=12712197
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP32145
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 212.00| 69| 253| 6| 86| 1
---------------------------------------------------------------------------
6- 86 (95.39/77.29) YGTTNNDTGTLHFQYL...EVIIRtmdSPLnlrPRPPNSRGPqtIADFIRrvNAEPGGFRALNEEEVRRNvIAERNGlHHEDVE
268- 339 (116.61/60.65) YGRMGSKSERLQATLLhngEVVGR...SSL...PRPLPDDAP..LDDRVK..EARNTIFAQELWHEINRE.GRTLHG.HHVRLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.49| 11| 52| 408| 418| 4
---------------------------------------------------------------------------
408- 418 (23.84/12.96) RGPP..PPYNLLL
461- 473 (18.65/ 8.39) KGPPtaPPSEALM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.01| 26| 35| 141| 169| 5
---------------------------------------------------------------------------
141- 169 (40.71/35.29) VSISPWLrsqVPIGSIGATQLDAPTPLTQ
178- 203 (40.30/26.11) ITIGKRL...VALNEAADTALAAANRLRQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.03| 16| 30| 511| 526| 6
---------------------------------------------------------------------------
511- 526 (30.83/17.61) YLLHPQSNHLTSSFPP
542- 557 (30.20/17.10) YLSNAVPRALTMYYYP
---------------------------------------------------------------------------
|