<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32139

Description Mediator of RNA polymerase II transcription subunit 31
SequenceMNPYGIPVESEDAQKLRFQVELEFVQCLANPNYLHFLAQRGYFKDAAFVNYLKYLLYWKEPEYAKYLKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTALGTTSLTGLAVGGQPVGGGVQGTLLSNDPAIMPNSSSNNGSNNGSSNSSNNGAGGGGTGGVGGVGGISNANNGSSNNGPNSGSVNVPSSVGQQQQQQQNGAGITQHNGVGGGGGVVGGGGMLGNPMGALGGGGSSLPGGGGINQKVP
Length264
PositionMiddle
OrganismAnopheles gambiae (African malaria mosquito)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Anophelinae> Anopheles.
Aromaticity0.08
Grand average of hydropathy-0.336
Instability index38.93
Isoelectric point8.31
Molecular weight27467.24
Publications
PubMed=12364791
PubMed=14747013
PubMed=17210077

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364129
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP32139
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     197.22|      42|      45|     129|     171|       1
---------------------------------------------------------------------------
  129-  171 (79.21/30.69)	GGQPVGGGVQGtLLSNDPAIMPNSSSNNGSNNGSSN..SS........NNGAG
  173-  219 (61.06/20.08)	GGTGGVGGVGG..ISNA....NNGSSNNGPNSGSVNvpSSvgqqqqqqQNGAG
  229-  257 (56.94/18.28)	GGGVVGGG..G.MLGNPMGAL...........GGGG..SS........LPGGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      26.87|       8|      16|      24|      37|       2
---------------------------------------------------------------------------
   24-   37 (10.80/19.84)	FVqclanpNYLHFL
   48-   55 (16.07/ 7.94)	FV......NYLKYL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.03|      15|      23|      72|      86|       3
---------------------------------------------------------------------------
   72-   86 (30.35/23.39)	CLYFLD...LLQYEHF..RR
   93-  112 (22.68/15.99)	CCKFIDdqaILLWQHYtrRR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP32139 with Med31 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) NDPAIMPNSSSNNGSNNGSSNSSNNGAGGGGTGGVGGVGGISNANNGSSNNGPNSGSVNVPSSVGQQQQQQQNGAGITQHNGVGGGGGVVGGGGMLGNPMGALGGGGSSLPGGGGINQKVP
144
264










Molecular Recognition Features






MoRF SequenceStartStop




NANANA