<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32139
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MNPYGIPVESEDAQKLRFQVELEFVQCLANPNYLHFLAQRGYFKDAAFVNYLKYLLYWKEPEYAKYLKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTALGTTSLTGLAVGGQPVGGGVQGTLLSNDPAIMPNSSSNNGSNNGSSNSSNNGAGGGGTGGVGGVGGISNANNGSSNNGPNSGSVNVPSSVGQQQQQQQNGAGITQHNGVGGGGGVVGGGGMLGNPMGALGGGGSSLPGGGGINQKVP |
| Length | 264 |
| Position | Middle |
| Organism | Anopheles gambiae (African malaria mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.336 |
| Instability index | 38.93 |
| Isoelectric point | 8.31 |
| Molecular weight | 27467.24 |
| Publications | PubMed=12364791
PubMed=14747013
PubMed=17210077
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32139
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 197.22| 42| 45| 129| 171| 1
---------------------------------------------------------------------------
129- 171 (79.21/30.69) GGQPVGGGVQGtLLSNDPAIMPNSSSNNGSNNGSSN..SS........NNGAG
173- 219 (61.06/20.08) GGTGGVGGVGG..ISNA....NNGSSNNGPNSGSVNvpSSvgqqqqqqQNGAG
229- 257 (56.94/18.28) GGGVVGGG..G.MLGNPMGAL...........GGGG..SS........LPGGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 26.87| 8| 16| 24| 37| 2
---------------------------------------------------------------------------
24- 37 (10.80/19.84) FVqclanpNYLHFL
48- 55 (16.07/ 7.94) FV......NYLKYL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.03| 15| 23| 72| 86| 3
---------------------------------------------------------------------------
72- 86 (30.35/23.39) CLYFLD...LLQYEHF..RR
93- 112 (22.68/15.99) CCKFIDdqaILLWQHYtrRR
---------------------------------------------------------------------------
|