<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32110
| Description |
DEHA2D14872p |
| Sequence | MQPKSIALLQKIDSNIEQILQKFQDIFEVAIIQDKSKELLSVESLTIESDALMIIRLCEDLLTITRTLKEAWCLGTVKVNPTDGLEEHQDTRAVFDKYNALTDKIAQFENMATLATDGIQ |
| Length | 120 |
| Position | Head |
| Organism | Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Debaryomyces.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.092 |
| Instability index | 38.78 |
| Isoelectric point | 4.54 |
| Molecular weight | 13569.46 |
| Publications | PubMed=15229592
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32110
No repeats found
No repeats found
|