<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32091
Description |
Uncharacterized protein |
Sequence | MLHEELSTDMDMITQLQDAILDLLTITSTSIEYITKRTQFEQTSISIPTTLSTPNAANRVEYKAAIETFVADIIRRSKDIQHLIDGLPRPGDSSERAQRLIELQDEIKIANEEYRQVLEQSKELVKELQLALDHTLGESPNDISIQSANYPAGTPYHNQNNEAN |
Length | 164 |
Position | Middle |
Organism | Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Cryptococcaceae> Cryptococcus>
Cryptococcus neoformans species complex.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.542 |
Instability index | 57.13 |
Isoelectric point | 4.60 |
Molecular weight | 18537.44 |
Publications | PubMed=15653466
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP32091
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.91| 20| 22| 8| 29| 1
---------------------------------------------------------------------------
10- 29 (32.66/21.33) MDMI...TQLQDAILDLLTITST
31- 53 (28.25/11.75) IEYItkrTQFEQTSISIPTTLST
---------------------------------------------------------------------------
|