<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32080
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MTESNDSGEPFQVFTSADRIRQLNEIDKDVAKLIHSAGLAIQALTNARSNDSTTLASADNSLDSHKARFKEATSQYFALLSSIDVRLRRQVYALEEASILAPDSSSRTGDSGSGAAAGGASNPLDVSWLNSRKDTVGKEKEAELWAAARQFVQQIHQANSEDKATVKVEGEQETMEVD |
| Length | 178 |
| Position | Head |
| Organism | Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Nidulantes.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.564 |
| Instability index | 39.67 |
| Isoelectric point | 4.85 |
| Molecular weight | 19259.84 |
| Publications | PubMed=16372000
PubMed=19146970
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32080
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.68| 11| 43| 4| 18| 1
---------------------------------------------------------------------------
4- 18 (15.02/20.98) SNDSgepfQVFTSAD
49- 59 (19.66/11.89) SNDS....TTLASAD
---------------------------------------------------------------------------
|