Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MTESNDSGEPFQVFTSADRIRQLNEIDKDVAKLIHSAGLAIQALTNARSNDSTTLASADNSLDSHKARFKEATSQYFALLSSIDVRLRRQVYALEEASILAPDSSSRTGDSGSGAAAGGASNPLDVSWLNSRKDTVGKEKEAELWAAARQFVQQIHQANSEDKATVKVEGEQETMEVD |
Length | 178 |
Position | Head |
Organism | Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Nidulantes. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.564 |
Instability index | 39.67 |
Isoelectric point | 4.85 |
Molecular weight | 19259.84 |
Publications | PubMed=16372000 PubMed=19146970 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32080 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 34.68| 11| 43| 4| 18| 1 --------------------------------------------------------------------------- 4- 18 (15.02/20.98) SNDSgepfQVFTSAD 49- 59 (19.66/11.89) SNDS....TTLASAD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EKEAELWAAA 2) PFQVFTS | 139 10 | 148 16 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab