| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MTESNDSGEPFQVFTSADRIRQLNEIDKDVAKLIHSAGLAIQALTNARSNDSTTLASADNSLDSHKARFKEATSQYFALLSSIDVRLRRQVYALEEASILAPDSSSRTGDSGSGAAAGGASNPLDVSWLNSRKDTVGKEKEAELWAAARQFVQQIHQANSEDKATVKVEGEQETMEVD |
| Length | 178 |
| Position | Head |
| Organism | Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Nidulantes. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.564 |
| Instability index | 39.67 |
| Isoelectric point | 4.85 |
| Molecular weight | 19259.84 |
| Publications | PubMed=16372000 PubMed=19146970 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP32080
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.68| 11| 43| 4| 18| 1
---------------------------------------------------------------------------
4- 18 (15.02/20.98) SNDSgepfQVFTSAD
49- 59 (19.66/11.89) SNDS....TTLASAD
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EKEAELWAAA 2) PFQVFTS | 139 10 | 148 16 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab