<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32070
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDCASSASFRAGPPSPSSPASGSLKENHPPYISSEHFPQTPTSPPLMSVSASNYATNIASSQPPSQATSQPANLSSPPSSAPMSTQTSQQPTLGPTNSFPTPASSVSGHFMGPTSVEDSEHVGTSLGHVQADSDAATATDLHTSSTQQSEHRRTDHDRELEGPTPGIDVRDFAGMDVLHTRDDTDAMDVDKDVNASAKSDGLSLESLQQDFSSAFHLCKSSLSATGPDPALDLISLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKHDPSAPGGLRHLTMWPEEEWQNQKVHGKEIKVADVDSASHNLQMKAMQMEPGTVPNNEYWEDVLGHEKPSKHAGHGDGKKAATLPNTARSPSQANETPLPTEPERARPSRGRKRHYDDNSFVGYGEGFADDDDDAAFYSNSEGMGKKKRKKEHVSKVPTPLPDRGGSYGVGMFGIGAR |
| Length | 460 |
| Position | Head |
| Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Fumigati.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.818 |
| Instability index | 48.13 |
| Isoelectric point | 5.87 |
| Molecular weight | 49023.27 |
| Publications | PubMed=16372009
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32070
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 114.78| 23| 23| 17| 39| 1
---------------------------------------------------------------------------
17- 39 (44.27/19.15) PSS.PASGSLK.ENHPPYISSEHFP
42- 65 (34.92/13.75) PTS.PPLMSVSaSNYATNIASSQPP
79- 101 (35.59/14.14) PSSaPMSTQ.T.SQQPTLGPTNSFP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.41| 26| 48| 268| 315| 2
---------------------------------------------------------------------------
285- 311 (46.78/52.44) PSAPGGLRHLTMW......PEEEWQnQKVHGKE
318- 349 (42.63/10.26) DSASHNLQMKAMQmepgtvPNNEYW.EDVLGHE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 108.45| 24| 48| 113| 136| 3
---------------------------------------------------------------------------
113- 136 (41.52/20.84) GPT.SVEDSEHVGTSLGHVQADSDA
163- 187 (38.57/18.92) GPTpGIDVRDFAGMDVLHTRDDTDA
399- 417 (28.35/12.26) ......DDNSFVGYGEGFADDDDDA
---------------------------------------------------------------------------
|