Description | Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MRDTPSCVPGSGPQRHAHPRYMQFLSLSYYPNHGFIYTSQPPEKTAQSPAPNAATPQTGLTPALGSATPSNAAAAGGSGMVMITVPLPSSGALFKHFVYACQPFWCHRHTVAVPGGMVYDVGDFRVRIGDVRQTQPAARVRGTVVEIEYRGPSLVTSIAAQYVQSKRAVNLGGATDVSESDHDSGIDLPLFGGIEDADIDAEYSATAALIREFWSKLGIEGAREAILVPDVGREVKEQLKRLKLQEKTGQTAPRNEGHALQQDDDPDPDAGTDLARQFMEIFRFNR |
Length | 286 |
Position | Head |
Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Fumigati. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.375 |
Instability index | 46.80 |
Isoelectric point | 5.90 |
Molecular weight | 30949.36 |
Publications | PubMed=16372009 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP32069 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.38| 19| 19| 31| 49| 2 --------------------------------------------------------------------------- 31- 49 (36.07/17.27) PNHGFIYTSQPPEKTAQSP 51- 69 (33.31/15.51) PNAATPQTGLTPALGSATP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PDAGTDLARQFMEIFRFNR 2) SYYPNHGFIY | 268 28 | 286 37 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab