| Description | Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MRDTPSCVPGSGPQRHAHPRYMQFLSLSYYPNHGFIYTSQPPEKTAQSPAPNAATPQTGLTPALGSATPSNAAAAGGSGMVMITVPLPSSGALFKHFVYACQPFWCHRHTVAVPGGMVYDVGDFRVRIGDVRQTQPAARVRGTVVEIEYRGPSLVTSIAAQYVQSKRAVNLGGATDVSESDHDSGIDLPLFGGIEDADIDAEYSATAALIREFWSKLGIEGAREAILVPDVGREVKEQLKRLKLQEKTGQTAPRNEGHALQQDDDPDPDAGTDLARQFMEIFRFNR |
| Length | 286 |
| Position | Head |
| Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Fumigati. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.375 |
| Instability index | 46.80 |
| Isoelectric point | 5.90 |
| Molecular weight | 30949.36 |
| Publications | PubMed=16372009 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP32069
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.38| 19| 19| 31| 49| 2
---------------------------------------------------------------------------
31- 49 (36.07/17.27) PNHGFIYTSQPPEKTAQSP
51- 69 (33.31/15.51) PNAATPQTGLTPALGSATP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) PDAGTDLARQFMEIFRFNR 2) SYYPNHGFIY | 268 28 | 286 37 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab