<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32066
Description |
Zgc:114119 |
Sequence | MSAPLPQKALATALSTVPPSQAQSGLPPGVPPPGAAPQGALREISPVYLCRIGQETVQDIVTRTMEIFQITRATQLPNGVTQSQAAYQDRFGKLQEHLRQLTLLFRKLRLLYERCVEMTSDLQETPAELVPYVGEEVSAVRVELCSPAVLQERQEVLEKVRQKNQEMKMLMDQMRNLLWDVNAMLTMRK |
Length | 189 |
Position | Head |
Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Cypriniformes>
Danionidae> Danioninae> Danio.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.275 |
Instability index | 58.96 |
Isoelectric point | 7.70 |
Molecular weight | 21256.51 |
Publications | PubMed=23594743
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP32066
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.45| 13| 48| 26| 38| 1
---------------------------------------------------------------------------
26- 38 (27.78/16.08) LPPGVPPPGAAPQ
76- 88 (24.67/13.53) LPNGVTQSQAAYQ
---------------------------------------------------------------------------
|