<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32054
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRASSASFRLGPPSPSSPAAGSLKSNHPSYTSTEHTPQTPTSPPLMSVSAQNYASNFTSSQTSPGQATSQPANLSSPPSSVPMSTQASQQPTVGTTNSFPTPASSVNGHFTGATPVDDSEQTEKSFGPEMGATSTADMNAPIQQTEHRRTDHDRQSEGPSAQTGVRDFGITGDQNMLNHGDAMDIDKGTADLSNYESSLESLQKEFTSAFHLCKSSHIATGPDPSYDLVSLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKHEPGMAGGLRQMTMWPEEEWQNQKVFGKEIKVADMDSALHNLQMRAMKMEPGTVTNNDYWEDILGHEKQSKHAGSGDGSKKAATPSNGVRVPSQANGTPNAAEPERSRPSRGRKRHYDDNSFVGYGEGYADDDDDGAFYSNSEGISKKKRKKDHVSKISTPLPERGGSYGVDQKQIALCPFFLPFFFFFFLGSNNRSEQIHPLPCCQASSLAFFSSRNLRSSRLSLVGSKRLSEFLACSLYTSRGSLDEQYIYSQ |
| Length | 533 |
| Position | Head |
| Organism | Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.766 |
| Instability index | 52.64 |
| Isoelectric point | 6.74 |
| Molecular weight | 57725.02 |
| Publications | PubMed=16372010
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP32054
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.22| 18| 20| 17| 34| 1
---------------------------------------------------------------------------
17- 34 (33.02/15.71) PSSPAAGSLKS....NHPS.YTS
39- 61 (23.20/ 8.81) PQTPTSPPLMSvsaqNYASnFTS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.94| 16| 131| 126| 146| 2
---------------------------------------------------------------------------
100- 123 (22.87/ 7.45) SFptpassvnGHFTGATPVDDS....EQ
127- 146 (25.07/24.96) SF........GPEMGATSTADMnapiQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 283.20| 83| 137| 184| 267| 4
---------------------------------------------------------------------------
184- 267 (135.77/74.94) AMDIDKGTADLSNYESSLESLQKEFTSAFHLCKSSHIATgPDPSYDLVSLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKG
324- 406 (147.43/77.83) AMKMEPGTVTNNDYWEDILGHEKQSKHAGSGDGSKKAAT.PSNGVRVPSQANGTPNAAEPERSRPSRGRKRHYDDNSFVGYGEG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.49| 16| 22| 68| 83| 5
---------------------------------------------------------------------------
68- 83 (29.37/17.06) QATSQPANLS.....SPPSSV
88- 108 (23.12/11.70) QASQQPTVGTtnsfpTPASSV
---------------------------------------------------------------------------
|