<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32043
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MSFHLSTKERLLLLIDDIEMIAKELIEQAHQKISSTELGDLLDLLVAKDEEFRKMLELAEEQAKVEDAMDKLRAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQANKRPVSSEELIKYAHRISSANAVSAPLTWCIGDLRRPYPTDIEMRNGLLGKSDQNLNGGQVPHQNSGLTPDVQRGLSGPGGAGSGGAGEVPSAFQNQFNWNLSELHMTMGASGNSVALETRAQDDVEVMSTDSSSSSSSDSQ |
| Length | 256 |
| Position | Middle |
| Organism | Drosophila pseudoobscura pseudoobscura (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.463 |
| Instability index | 46.21 |
| Isoelectric point | 5.06 |
| Molecular weight | 27999.12 |
| Publications | PubMed=15632085
PubMed=17994087
PubMed=23185243
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblMetazoa
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa
|
Interaction
Repeat regions
| Repeats |
>MDP32043
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.93| 12| 96| 23| 35| 1
---------------------------------------------------------------------------
23- 35 (17.53/13.94) KELIEQAHqKISS
122- 133 (21.40/11.77) EELIKYAH.RISS
---------------------------------------------------------------------------
|