| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MNPLDKIHALDEIEKEIILCMQSAGQALQELGKEKSSQKNAETQSQQFLKSLSSVESKLSEQINYLTQVSTGQPHEGSGYASAKVLQMAWHRIQHARSRVRELEETKAKHSHAARQQQKRQQEHAAAQQQQQQQQQAAAAVAQQQQQQQQAGGGVGVSPGADTGGVGHAIGGDASTGMSTN |
| Length | 181 |
| Position | Head |
| Organism | Drosophila pseudoobscura pseudoobscura (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Sophophora. |
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.884 |
| Instability index | 66.58 |
| Isoelectric point | 7.11 |
| Molecular weight | 19558.32 |
| Publications | PubMed=15632085 PubMed=17994087 PubMed=23185243 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblMetazoa |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:EnsemblMetazoa |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:EnsemblMetazoa |
| Binary Interactions |
| Repeats |
>MDP32042
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.91| 25| 26| 95| 120| 1
---------------------------------------------------------------------------
95- 120 (35.88/16.65) HARSRVRELEETKAKhSHAARQQQKR
124- 148 (41.02/15.70) HAAAQQQQQQQQQAA.AAVAQQQQQQ
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AAAAVAQQQ 2) QAGGGVGVSPG 3) RELEETKAKHS | 137 150 101 | 145 160 111 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab