<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32032
| Description |
Uncharacterized protein |
| Sequence | MLVRFGGGFGIWAASASAGTTLALLLRGNVAHALQSGAPTGPHLDTLDPQTFKEGQAELARDMIVQAQRIEYLASELPGLQNSERDQLRIISGLEEEIAGLEAQRLEAVRERDEVFGQLDALLRSLQRP |
| Length | 129 |
| Position | Middle |
| Organism | Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Chaetomiaceae> Chaetomium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.167 |
| Instability index | 41.82 |
| Isoelectric point | 4.87 |
| Molecular weight | 14005.67 |
| Publications | PubMed=25720678
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32032
No repeats found
No repeats found
|