<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32031
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MSGLEFVVLRTRRDRPGAGTGVWVINKQTRRKQSPQDEIIVHSSYFVVGENIYMAASFADILSSRISTLLPAYRRSPRPSSTNSATTFMDENPITGKPGEFLLASTGRKAVNLSTAAALNAKKGALMPMLPTLNTKLGGVGSGGAGGAGGGGGGGENPLSAKPTGKETKSPKTPGGGSLQKGKKRKGSKAAVTPQ |
Length | 195 |
Position | Head |
Organism | Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Chaetomiaceae> Chaetomium.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.423 |
Instability index | 55.01 |
Isoelectric point | 10.65 |
Molecular weight | 20111.74 |
Publications | PubMed=25720678
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP32031
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.61| 10| 63| 91| 100| 2
---------------------------------------------------------------------------
91- 100 (20.45/12.18) ENPITGKP.GE
156- 166 (15.17/ 7.16) ENPLSAKPtGK
---------------------------------------------------------------------------
|