<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32019
Description |
Uncharacterized protein |
Sequence | MNPNMNMMPMSGPQMMQVMQSSPQPMMPAVPPGPVPQQPLQQQQPAEKLDNISRVKSLLGPLRESMFLTIRSSAFTLQQNNLADNLKRDTGAHGHHVPRFDKHLEDFYACCDQIELHLKTAMQCLQQQNSSNHYLPGLVTPMRMESFMPENAGPIPYPTYLNTVRVHVQSAKDIHDTLISAAQNISQAD |
Length | 189 |
Position | Tail |
Organism | Drosophila pseudoobscura pseudoobscura (Fruit fly) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.510 |
Instability index | 73.15 |
Isoelectric point | 6.43 |
Molecular weight | 21216.15 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP32019
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.23| 26| 83| 38| 68| 1
---------------------------------------------------------------------------
38- 68 (39.63/28.48) QPLQQQQPAEKldnisRVKSLLGPLRESMFL
123- 148 (49.61/25.50) QCLQQQNSSNH.....YLPGLVTPMRMESFM
---------------------------------------------------------------------------
|