<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32011
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MPVEVFLITVVPAADTTKARSVLHGYTETRPVTHRFTRVRHVRRLDQSIRGIPILRSLQSSNPKPDSLAQWQDLHSTLSRQQYMLTERVDITQDVDAAVAAGQPVPMSEQTQKGERILRFNDFPDPPNPRVPQTVMQRKQIDIREPGPLLEQHMADSGFSVANEYIEETYHWWDNNNLEFVLWRQYNDLPNPTPAPLVQVAGQANWMVPDMSKMEPVAPFWMLYVRALVDANPVDRMAERMAEAHGRLGKVEKELEGVFSFMVFDRRALDTRYTGEDPE |
| Length | 279 |
| Position | Head |
| Organism | Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Sordariaceae> Neurospora.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.542 |
| Instability index | 53.18 |
| Isoelectric point | 5.57 |
| Molecular weight | 32104.06 |
| Publications | PubMed=12712197
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
termination of RNA polymerase II transcription GO:0006369 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP32011
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 133.02| 34| 65| 115| 148| 1
---------------------------------------------------------------------------
54- 106 (29.48/11.57) ..IL.................RSLQSSNP.KPDSLAQwqdlhSTLSRQQY..MLTErvditqdvdaavaagqPVP
115- 148 (64.05/31.90) ERIL.................RFNDFPDP.PNPRVPQ.....TVMQRKQI..DIRE................PGP
164- 216 (39.49/17.45) EYIEetyhwwdnnnlefvlwrQYNDLPNPtPAPLV.Q.....VAGQANWMvpDMSK................MEP
---------------------------------------------------------------------------
|