<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP32001
| Description |
Mediator of RNA polymerase II transcription subunit 16 (Fragment) |
| Sequence | YDISKDIIALNSIRELLVMIRIWGLLNPQCLPVFSRSADNLDILGTLFRLLTKLSLNPNEPDDLLLDECCLLPNQVLIPQLQYVPSRTMIASPLLPHVTLPVMCDYGVENESLKFCPEVPIVEGGLSNDNVIDSVMYLQLGRRPPSLRRCTRCGSCSSVVSVAKTAAMKAWEQRWIDKCRCNGFWRLEVA |
| Length | 190 |
| Position | Tail |
| Organism | Aedes aegypti (Yellowfever mosquito) (Culex aegypti) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Culicinae> Aedini> Aedes> Stegomyia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | 0.135 |
| Instability index | 56.87 |
| Isoelectric point | 5.89 |
| Molecular weight | 21389.88 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP32001
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 105.58| 32| 32| 85| 116| 1
---------------------------------------------------------------------------
85- 116 (58.36/36.91) PSRTMIASPLL.PHVTLPVM.CDYGVENESLKFC
117- 150 (47.22/28.63) PEVPIVEGGLSnDNVIDSVMyLQLGRRPPSLRRC
---------------------------------------------------------------------------
|