<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31994
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MYELLLYGQVPVGRHEQVLKILAGVAAMQPLRILERCIIYKPQREPEEPGLNVRRGGTQNIALKQGNKPATAAAALYYTKLIQKLSEDDFGVEHGKPLSADVKDGEEAKWSMRWEDQPDTGDRGVSIRFTNTTDLLSGDPHAHMIATGPNRFVTEYYVEGHRFVHGNVIIFLHRVLHEPGVRSLEVAPKTQLPDFAALQLLDMSGAYILEVKLRVQDFKDAATLESGVNELKGFQKQMAGCVELSLPDRLSLDTRVKYKPPHAGAAPAQNRPR |
Length | 273 |
Position | Head |
Organism | Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Phaeosphaeriaceae>
Parastagonospora.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.389 |
Instability index | 31.54 |
Isoelectric point | 7.14 |
Molecular weight | 30427.48 |
Publications | PubMed=18024570
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
termination of RNA polymerase II transcription GO:0006369 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP31994
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 121.04| 36| 215| 20| 55| 1
---------------------------------------------------------------------------
20- 55 (63.98/38.95) KILAGVAAMQ.PLRI.LERCIIYKPQREPEEPGLNVRR
236- 273 (57.07/34.06) KQMAGCVELSlPDRLsLDTRVKYKPPHAGAAPAQNRPR
---------------------------------------------------------------------------
|