Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MSTEADQAIKEQTSTPAQSGLQSKSSPAQQSQTYNQIAATHIDKLSKINEQIPKLLTYFAAAISQLTNNPVETPAQKDQPDTRQAREQALWMQTVFVGLSINQIREALLTQISDLERYGVIPATQAKYTAQQIGKNAPQHDPEASVKNGGYGDFDVGVLNARAASGQVGGEDVLDRVKAIVEELKKRDEGEEDGEKMAVDG |
Length | 201 |
Position | Head |
Organism | Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Parastagonospora nodorum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Phaeosphaeriaceae> Parastagonospora. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.643 |
Instability index | 40.67 |
Isoelectric point | 4.85 |
Molecular weight | 21825.94 |
Publications | PubMed=18024570 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31990 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 95.97| 29| 55| 7| 36| 1 --------------------------------------------------------------------------- 7- 36 (44.38/27.61) QAIKEQTSTPAQSGlQSKSSPAQQSQTYNQ 65- 93 (51.59/28.47) QLTNNPVETPAQKD.QPDTRQAREQALWMQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EDVLDRVKAIVEELKKRDE 2) MSTEADQAI | 171 1 | 189 9 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab