<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31987
| Description |
Os08g0523600 protein (Fragment) |
| Sequence | PVSGPEGLNELQKLAVRFEEKIYTGATSRSDYLRKLSLKMLSLETKTQQSPGNAQVIQNQNPPGSGVTMLPKKHLSGAQKRNKRKRGDQLIGSQKK |
| Length | 96 |
| Position | Tail |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.949 |
| Instability index | 51.22 |
| Isoelectric point | 10.38 |
| Molecular weight | 10616.08 |
| Publications | PubMed=16100779
PubMed=24280374
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31987
No repeats found
No repeats found
|