| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MDGGAATNASGVAAAAAAAGNGVQAGGGGERAEDASKQNLALMMASIQRTLGLLHQLNLNVSSFSSASQLPLLQRLNSLVAELDTMQKHAEGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCIAKNQVTKGKTDAFKSLRKHLLEELEQAFPEDVEAYREIRATAAAESKQLAQSQSALPNGDVKVKPEH |
| Length | 190 |
| Position | Middle |
| Organism | Oryza sativa subsp. japonica (Rice) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade> Oryzoideae> Oryzeae> Oryzinae> Oryza> Oryza sativa. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.329 |
| Instability index | 31.64 |
| Isoelectric point | 5.23 |
| Molecular weight | 20107.35 |
| Publications | PubMed=16100779 PubMed=23299411 PubMed=24280374 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
| Binary Interactions |
| Repeats |
>MDP31986
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.59| 13| 16| 46| 58| 1
---------------------------------------------------------------------------
46- 58 (22.61/17.01) SIQRTLGLLHQLN
65- 77 (21.98/16.35) SSASQLPLLQRLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.21| 14| 16| 4| 17| 2
---------------------------------------------------------------------------
4- 17 (21.31/12.76) GAATNASGVAAAAA
22- 35 (23.89/15.17) GVQAGGGGERAEDA
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AATNASGVAAAAAA 2) EAYREIRAT 3) GDVKVKPEH 4) LRKHLL | 5 156 182 139 | 18 164 190 144 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab