<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31977
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRTSSASLRAGPPSPSSPAAGLLKETHSSFASSEPTPQTPTSPPLMSVSAQNYASNFASSQTSSSQATSQPANLSSPPSSAPMSAQASQQPAVGMTASFPTPASSVTGHVAGATSMDDTESTDNKPLGSDAGATSMAPTDPSLRQVEHRPTNHDRPLGGLDTDTGTSVAKAAAYDGAMDIDQDTATTSQHQSSLDSLQKEFSSPFHLCKNSYTATGPDPALDLVSLYGLGPGGEIRRKNGPSLGLAGRNKPVKNDPNKSGGLRHMTMWPEEEWQNQKVYGKDIKAADIDSTLYNLQLKAMKMEPGMVPNNDYWEDVLGHEKPSKHAGSGEGSKKPAAAPNGARIPGPPNGTPGATDAERTRPSRGRKRHYDDNSFVGYGEGYADDDDDGAFYSNGEGIGKKKRKKVG |
| Length | 409 |
| Position | Head |
| Organism | Aspergillus terreus (strain NIH 2624 / FGSC A1156) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Circumdati.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.846 |
| Instability index | 50.92 |
| Isoelectric point | 5.94 |
| Molecular weight | 42820.32 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31977
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 97.02| 23| 24| 14| 36| 1
---------------------------------------------------------------------------
8- 32 (36.37/11.74) ASLRagPPSPSSPAAGLLKETH....SSF
33- 59 (26.83/ 7.12) ASSEptPQTPTSP..PLMSVSAqnyaSNF
69- 88 (33.82/10.50) ATSQ..PANLSSPPS...SAPM....SAQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
5| 282.90| 52| 98| 115| 166| 2
---------------------------------------------------------------------------
115- 165 (81.00/39.55) .............ATSMD.DT.ESTDNKPLGSDA..............GATSMAPTDPS....LRQVEHRPTN..HDRPLG.GL..DTD
166- 234 (39.86/15.65) TgtsvakaaaydgAMDIDqDT.ATTSQHQSSLDSlqkefsspfhlcknSYTATGP.DPA....LDLV...........SLY.GL..GPG
236- 284 (44.00/18.05) ...................EI.RRKNGPSLGL.A..............GRNKPVKNDPNksggLRHMTMWPEEewQNQKVY.GK..D..
287- 331 (56.35/25.23) .............AADID.STlYNLQLKAMKMEP..............G...MVPNNDY....WEDV....LG..HEKPSK.HA..GSG
332- 389 (61.69/28.33) E.......gskkpAAAPN.GA.R.IPGPPNGT.P..............GATDAERTRPS....RGRKRHYDDN..SFVGYGeGYadDDD
---------------------------------------------------------------------------
|