<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31964

Description Prostate tumor-overexpressed gene 1 protein homolog
SequenceMVRPRRAPHRSGAGGPLGGRGRPPRPLVVRAVRSRSWPAGPRGPQPPRIRARSAPPMEGARVFGALGPIGPSSPGLTLGGLAVNEHRLSNKLLAWSGVLEWQEKRRPFSDSAAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRNSQLAQFHFTNRDCDSLKGLCRIMGNGFAGCMLFPHISPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNAIRQVITTRKQAVGPGGVHSGPVQIVNNKFLAWSGVMEWQEPRPEPNSRSKRWLPSHVYVNQGEILRTDQWPRRLFMQLIPQQLLTTLVPLFRNSRLVQFHFTKDMETLKSLCRIMDNGFAGCVHFSYKASCEVRVLMLLYSSEKKIFIGLIPHDQSNFVNGIRRVIANQQQVLQRSLEQEQQQRGMGG
Length416
PositionUnknown
OrganismRattus norvegicus (Rat)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Myomorpha> Muroidea> Muridae> Murinae> Rattus.
Aromaticity0.08
Grand average of hydropathy-0.336
Instability index50.54
Isoelectric point10.80
Molecular weight46848.01
Publications
PubMed=15489334

Function

Annotated function May activate transcription. Required for nuclear translocation of FLOT1. Promotes cell proliferation (By similarity).
GO - Cellular Component
nucleoplasm	GO:0005654	IEA:Ensembl
perinuclear region of cytoplasm	GO:0048471	IEA:UniProtKB-SubCell
plasma membrane	GO:0005886	IEA:UniProtKB-SubCell
transcription regulator complex	GO:0005667	IBA:GO_Central
GO - Biological Function
GO - Biological Process
positive regulation of transcription by RNA polymerase II	GO:0045944	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP31964
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     584.44|     145|     159|      90|     238|       1
---------------------------------------------------------------------------
   90-  238 (284.90/205.70)	NKLLAWSGVLEWQEKrRPFSDSaaKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRNSQLAQFHFTnRDCDSLKGLCRIMGNGFAGCMLFPHISPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNAIRQVITTRKQ
  255-  399 (299.54/201.68)	NKFLAWSGVMEWQEP.RPEPNS..RSKRWLPSHVYVNQGEILRTDQWPRRLFMQLIPQQLLTTLVPLFRNSRLVQFHFT.KDMETLKSLCRIMDNGFAGCVHFSYKASCEVRVLMLLYSSEKKIFIGLIPHDQSNFVNGIRRVIANQQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     121.84|      24|      24|       2|      25|       2
---------------------------------------------------------------------------
    2-   25 (50.76/22.58)	VRPRRAPHRSGAG..GPLGGRGRPPR
   29-   48 (40.79/16.79)	VRAVRS..RSWPA..GPRG..PQPPR
   49-   71 (30.29/10.69)	IRARSAPPMEGARvfGALGPIG.P..
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP31964 with Med25 domain of Kingdom Metazoa

Unable to open file!