<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31952
Description |
Uncharacterized protein (Fragment) |
Sequence | MMNLMNISDCEQGSWESGLSYECRSLLFKALHNLIERSLLSRDFVRLGKWFVQPYDYPAPRFDPSDPDNPNGIGPEAYATPPHNASHLSFAFAFFVHGESSVCASIDVRQHPAVRRLTRWHMQEAQASTGGINVILAPHGLAGTLTGQSFRPPETTAKFIDDWGHFYPLDKSSSLTDSSVVEVIVKGSKMRYPSCYVLVTDLDDYTNPMFSSFGCCHVNLTRANESIPKSNCINPNESIPITVVTPPPSPIQINSRVPQPGAHTVSVENINSMSRDQTAAQILAEQTWQQCLYSGAFLDKASKEDGCWDYVEPTRKTICTCLNCNKQN |
Length | 328 |
Position | Middle |
Organism | Dendroctonus ponderosae (Mountain pine beetle) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia>
Curculionidae> Scolytinae> Dendroctonus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.343 |
Instability index | 52.05 |
Isoelectric point | 5.79 |
Molecular weight | 36455.67 |
Publications | PubMed=23537049
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP31952
No repeats found
|