<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31952
| Description |
Uncharacterized protein (Fragment) |
| Sequence | MMNLMNISDCEQGSWESGLSYECRSLLFKALHNLIERSLLSRDFVRLGKWFVQPYDYPAPRFDPSDPDNPNGIGPEAYATPPHNASHLSFAFAFFVHGESSVCASIDVRQHPAVRRLTRWHMQEAQASTGGINVILAPHGLAGTLTGQSFRPPETTAKFIDDWGHFYPLDKSSSLTDSSVVEVIVKGSKMRYPSCYVLVTDLDDYTNPMFSSFGCCHVNLTRANESIPKSNCINPNESIPITVVTPPPSPIQINSRVPQPGAHTVSVENINSMSRDQTAAQILAEQTWQQCLYSGAFLDKASKEDGCWDYVEPTRKTICTCLNCNKQN |
| Length | 328 |
| Position | Middle |
| Organism | Dendroctonus ponderosae (Mountain pine beetle) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia>
Curculionidae> Scolytinae> Dendroctonus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.343 |
| Instability index | 52.05 |
| Isoelectric point | 5.79 |
| Molecular weight | 36455.67 |
| Publications | PubMed=23537049
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31952
No repeats found
|