<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31949
| Description |
Uncharacterized protein (Fragment) |
| Sequence | MNPLKEPSPPGSAMATPTNTNGNLVDEFEEAFQSCLNVLTKEEAVPATDKDEIKVEVEHTMYRFIDMARQMEAYFLQKRFLLSALKPEINIKEDVNDLRIELVRKEELIKRHYEKIAVWQNLLADLHSYAKSPAQAGGNSTPSGAGSSGSSILPSPVQSLAGNQPTSQLMSSMPTSMQQLQHQQLQQQHQQLQQQQLQQMQMQQMQVDRR |
| Length | 210 |
| Position | Head |
| Organism | Dendroctonus ponderosae (Mountain pine beetle) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia>
Curculionidae> Scolytinae> Dendroctonus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.669 |
| Instability index | 71.66 |
| Isoelectric point | 5.56 |
| Molecular weight | 23734.61 |
| Publications | PubMed=23537049
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31949
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.30| 12| 145| 7| 18| 1
---------------------------------------------------------------------------
7- 18 (25.54/15.14) PSPPGS.AMATPT
154- 166 (19.76/10.32) PSPVQSlAGNQPT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.14| 10| 18| 177| 186| 2
---------------------------------------------------------------------------
177- 186 (19.77/ 9.56) MQQLQHQQLQ
197- 206 (20.37/10.06) LQQMQMQQMQ
---------------------------------------------------------------------------
|