<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31949

Description Uncharacterized protein (Fragment)
SequenceMNPLKEPSPPGSAMATPTNTNGNLVDEFEEAFQSCLNVLTKEEAVPATDKDEIKVEVEHTMYRFIDMARQMEAYFLQKRFLLSALKPEINIKEDVNDLRIELVRKEELIKRHYEKIAVWQNLLADLHSYAKSPAQAGGNSTPSGAGSSGSSILPSPVQSLAGNQPTSQLMSSMPTSMQQLQHQQLQQQHQQLQQQQLQQMQMQQMQVDRR
Length210
PositionHead
OrganismDendroctonus ponderosae (Mountain pine beetle)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia> Curculionidae> Scolytinae> Dendroctonus.
Aromaticity0.05
Grand average of hydropathy-0.669
Instability index71.66
Isoelectric point5.56
Molecular weight23734.61
Publications
PubMed=23537049

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP31949
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.30|      12|     145|       7|      18|       1
---------------------------------------------------------------------------
    7-   18 (25.54/15.14)	PSPPGS.AMATPT
  154-  166 (19.76/10.32)	PSPVQSlAGNQPT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.14|      10|      18|     177|     186|       2
---------------------------------------------------------------------------
  177-  186 (19.77/ 9.56)	MQQLQHQQLQ
  197-  206 (20.37/10.06)	LQQMQMQQMQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31949 with Med28 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AKSPAQAGGNSTPSGAGSSGSSILPSPVQSLAGNQPTSQLMSSMPTSMQQLQHQQLQQQHQQLQQQQLQQMQMQQMQVDRR
130
210










Molecular Recognition Features






MoRF SequenceStartStop




NANANA