<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31948
| Description |
Mediator of RNA polymerase II transcription subunit 31 (Fragment) |
| Sequence | MKMTGLPGKNWNYVTGVPETEDQQRMRFQVELEFVQCLGNPNYLNFLAQRGYFKDPTFIHYLKYLIYWKEPDYAKYLKYPMCLYFLDLLQYEHFRRELVNAQCTKFIDDQQILLWQHYTRRRSRLMTTAASNGTSQDQNPGSQATNPQQNGHITSSMKMT |
| Length | 160 |
| Position | Middle |
| Organism | Dendroctonus ponderosae (Mountain pine beetle) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia>
Curculionidae> Scolytinae> Dendroctonus.
|
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.713 |
| Instability index | 49.61 |
| Isoelectric point | 8.93 |
| Molecular weight | 19087.54 |
| Publications | PubMed=23537049
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31948
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 95.57| 22| 25| 58| 79| 1
---------------------------------------------------------------------------
32- 52 (18.80/ 6.79) ....LEFVQCLGNPNYLNFLAqrgY
58- 79 (41.05/20.62) FIHYLKYLIYWKEPDYAKYLK...Y
85- 106 (35.72/17.31) FLDLLQYEHFRRELVNAQCTK...F
---------------------------------------------------------------------------
|