<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31947
| Description |
Mediator of RNA polymerase II transcription subunit 7 (Fragment) |
| Sequence | MSSDAVQVSSLPLPPMQYVSQYTDEMIRRGRAPKPPPPIQDTYHMFGNTFNTEESIIRPLESQGIKRLYPQHFDRRRELKKLNLSLLANFLDLLDLLVNCPDSPKRTEKVDDLSLLFIHIHHLLNEFRPHQARETLRVMMELQKRQRIETTNRFQKHLDKVKEILQQAVRDLPEPMDLDSKIMADVDLITKHDKMDDSNSNCDPCDIRDRIMCSIVDNM |
| Length | 219 |
| Position | Middle |
| Organism | Dendroctonus ponderosae (Mountain pine beetle) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia>
Curculionidae> Scolytinae> Dendroctonus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.629 |
| Instability index | 54.02 |
| Isoelectric point | 6.24 |
| Molecular weight | 25689.31 |
| Publications | PubMed=23537049
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31947
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.43| 22| 26| 74| 97| 1
---------------------------------------------------------------------------
74- 97 (30.96/25.35) DRRRELKKL.NLSLLanFLDLLDLL
102- 124 (34.48/21.57) DSPKRTEKVdDLSLL..FIHIHHLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.85| 13| 26| 174| 186| 2
---------------------------------------------------------------------------
174- 186 (22.92/11.15) EPMDLDSKIMADV
203- 215 (25.93/13.35) DPCDIRDRIMCSI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.69| 12| 26| 125| 136| 4
---------------------------------------------------------------------------
125- 136 (21.87/13.53) NEFRPH..QARETL
152- 165 (15.82/ 8.21) NRFQKHldKVKEIL
---------------------------------------------------------------------------
|