Description | Uncharacterized protein (Fragment) |
Sequence | MTSRALPQSKEALLKSYRTRLKDDVKSMLENFEEIIKVAKGEHDTQLSRLTQCEQDTYEMHVRSANIVRAGESLMKLVSDIKQYLILNDFPSVNEAITQNSKLFRTKQAECDQKLMSLRDDMAADLYDLEEEYYQSINK |
Length | 139 |
Position | Head |
Organism | Dendroctonus ponderosae (Mountain pine beetle) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia> Curculionidae> Scolytinae> Dendroctonus. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.673 |
Instability index | 49.63 |
Isoelectric point | 5.27 |
Molecular weight | 16174.19 |
Publications | PubMed=23537049 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31946 No repeats found |
MoRF Sequence | Start | Stop |
1) DLYDLEEEYYQ 2) KEALLKSYRTRLKD 3) RALPQ | 125 10 4 | 135 23 8 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab