<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31940

Description Uncharacterized protein (Fragment)
SequenceMAGPTHHFMQNMNNPNQGGLRSSFGPGVMQNSLDGTGMQNALPNQMSQLANPIMSQMTNAMAGGISPINSQMGGPMQNALGAGGMQAAMPNQMGGQIPQLGNPMMGQIANPMSGMMSPITTPMTEFNPSLNHQMHPGSQTTGVAPTPPQSYTPQQQQQQQSKDYGQASLCRLGQETVQDIVSRTQEVFQTLKAIQPPAGTTQSTNASNEKKAKVQELLRTIRVLFKRLRLIYEKSNENNQIQGMEYTHIESLIPFKDELDPKHEEKKNSEAYRLACEESKEVMAQIILKNQQLKEIIDHIRRIIWEINTMLTMRKS
Length316
PositionHead
OrganismDendroctonus ponderosae (Mountain pine beetle)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Coleoptera> Polyphaga> Cucujiformia> Curculionidae> Scolytinae> Dendroctonus.
Aromaticity0.04
Grand average of hydropathy-0.640
Instability index51.38
Isoelectric point8.48
Molecular weight34977.60
Publications
PubMed=23537049

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP31940
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.01|      18|      18|      57|      74|       1
---------------------------------------------------------------------------
   49-   71 (24.54/ 7.09)	LANpimsqMTNAMAGGISPINSQ
  104-  122 (26.47/ 8.11)	MMG....qIANPMSGMMSPITTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.93|      13|      19|       3|      21|       2
---------------------------------------------------------------------------
    3-   19 (21.46/17.59)	GPthHFMQnmNNPNQGG
   25-   37 (24.47/ 9.11)	GP..GVMQ..NSLDGTG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     109.75|      25|      81|     151|     175|       3
---------------------------------------------------------------------------
  151-  175 (43.60/30.28)	Y.TPQQQQQQQSKDYGQ.ASLCRLGQE
  232-  258 (31.46/19.73)	YeKSNENNQIQGMEYTHiESLIPFKDE
  259-  281 (34.69/22.53)	L.DPKHEEKKNSEAYRL.A..CEESKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.86|      18|      35|     177|     194|       5
---------------------------------------------------------------------------
  177-  194 (28.26/25.79)	VQDIVSRTQEVFQTLKAI
  214-  231 (27.60/25.03)	VQELLRTIRVLFKRLRLI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      33.70|       9|      18|      72|      81|       6
---------------------------------------------------------------------------
   72-   81 (15.00/11.07)	MGGPMQNaLG
   93-  101 (18.70/ 9.15)	MGGQIPQ.LG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31940 with Med30 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MAGPTHHFMQNMNNPNQGGLRSSFGPGVMQNSLDGTGMQNALPNQMSQLANPIMSQMTNAMAGGISPINSQMGGPMQNALGAGGMQAAMPNQMGGQIPQLGNPMMGQIANPMSGMMSPITTPMTEFNPSLNHQMHPGSQTTGVAPTPPQSYTPQQQQQQQSKDYGQASL
1
169










Molecular Recognition Features






MoRF SequenceStartStop




NANANA