<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31934
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MYELFITTLVDDEEIQAACSVLSGFCAMPAWQSLHRVLYFKGPAKPGGISKQNSIVKTPRKDIQMLWKDLHQQLSRQSYILQARYEVYKDRDFGQNASEADLNARSGILRWTDFPEPPQPRSVVTQRKKTEIWDQRNLPSVMRDNNYQFKTEAIEETYQFFKDEIEFCLSRHYMIPPNGEGTPLTQLPPWESFNPGDPGRRWMFLIKVHVHQDNKPDEVIKAHAQLADVRRDLEGVFDFKMFDRRIHDTRVAVEMRNAPAPLPQVMTVTDQR |
| Length | 272 |
| Position | Head |
| Organism | Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) (Cucumber anthracnose fungus) (Colletotrichum lagenarium) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum>
Colletotrichum orbiculare species complex.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.658 |
| Instability index | 58.12 |
| Isoelectric point | 6.67 |
| Molecular weight | 31798.81 |
| Publications | PubMed=23252678
PubMed=30893003
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31934
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.33| 15| 20| 68| 87| 1
---------------------------------------------------------------------------
68- 84 (20.51/28.76) KDLHQQLSRQSyiLQAR
91- 105 (24.82/13.45) RDFGQNASEAD..LNAR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.14| 21| 88| 124| 150| 2
---------------------------------------------------------------------------
124- 144 (37.28/15.66) VTQRKKTE..IWDQR.NLPSVMRD
210- 232 (28.95/ 9.81) VHQDNKPDevIKAHA.QLADVRRD
247- 266 (21.91/12.71) HDTRVAVE..MRNAPaPLPQVM..
---------------------------------------------------------------------------
|