Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MDKPNALGISADEYKAIEQTRQRLFQLSNSIQGLKNDVYKSNPLPPPASLQAQSQILLRNLQTLLDTLTENTHVFQHLHVFPDAAYPGRTQENILLQLLRKKLEPGVEEWVERGRETTRELRAAPGGDGDGEARLEEVWREVRSWTVERVQRYVLEEAGDVYTAEEREAGIEHVRTGLKRGLEEDDESDEEDEDVVMEGQQEQAQAATPAVQKGPEPELLFWFGARGDFELPKNVELLSQAGTKRGPMGGRQ |
Length | 252 |
Position | Head |
Organism | Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) (Cucumber anthracnose fungus) (Colletotrichum lagenarium) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Glomerellaceae> Colletotrichum> Colletotrichum orbiculare species complex. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.796 |
Instability index | 47.45 |
Isoelectric point | 4.76 |
Molecular weight | 28468.28 |
Publications | PubMed=23252678 PubMed=30893003 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31930 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 104.55| 32| 33| 107| 138| 1 --------------------------------------------------------------------------- 107- 138 (54.68/27.09) VEEW.VERGRETTRELRAAPGGDGDGEARLEEV 142- 174 (49.87/24.20) VRSWtVERVQRYVLEEAGDVYTAEEREAGIEHV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LKNDVYK 2) VQKGPEPELLFWFGARGDFELPKNVELLSQAGT | 34 211 | 40 243 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab