<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31918
Description |
RNA polymerase II holoenzyme cyclin-like subunit |
Sequence | MSANYWQSTQYRFWSFTKEQLATMRQKLEEDNAELVRMFPLPQQRHLYIYFNQQLIRLAKRLTIRQQSMATAQVYMKRFYSKVEIRRTNPYLVIATAIYLACKIEESPQHIRLIVTEARQMWGDLVAIDTSKLGECEFFMISEMRSQLIVFQPYRTITALRSELSLVDDEVQLARSVINDHFMTDLPLLYPPHIIAMVAILLALVLRPNNSGPGQNTSGAAAAAGLAAAQQALMRAQGQQAQGGMPEPAAVEPKEKRQQDRVSRVQKFAKWLVDSNVEIASMVDATQEIISFYECYEHYNDKLTREQINRFVKARGLDK |
Length | 319 |
Position | Kinase |
Organism | Fusarium oxysporum f. sp. cubense (strain race 1) (Panama disease fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium oxysporum species complex.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.274 |
Instability index | 55.77 |
Isoelectric point | 9.01 |
Molecular weight | 36745.98 |
Publications | PubMed=24743270
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP31918
No repeats found
|