| Description | Uncharacterized protein |
| Sequence | MDTSTPTNLMDKHQKIISEILRSYRDLMNCVTVNGMDKEKQGDYEAQANKLNYRDPDTMAAAGLRTQRKFDELYESIKELLALTRTIKELWVFGPVDRADDHRKEKEEQIDRDVAEITTLFNKIDANALRELAEKNGGTWRMEQV |
| Length | 145 |
| Position | Head |
| Organism | Fusarium oxysporum f. sp. cubense (strain race 1) (Panama disease fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium> Fusarium oxysporum species complex. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.842 |
| Instability index | 18.52 |
| Isoelectric point | 5.17 |
| Molecular weight | 16852.83 |
| Publications | PubMed=24743270 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP31911
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.39| 21| 27| 24| 45| 1
---------------------------------------------------------------------------
24- 45 (35.70/27.20) YRDlMNCVTVNGMDKEKQGD..YE
53- 75 (33.70/20.93) YRD.PDTMAAAGLRTQRKFDelYE
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DYEAQANKLNYRDP 2) IKELL | 43 77 | 56 81 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab