Description | Uncharacterized protein |
Sequence | MDTSTPTNLMDKHQKIISEILRSYRDLMNCVTVNGMDKEKQGDYEAQANKLNYRDPDTMAAAGLRTQRKFDELYESIKELLALTRTIKELWVFGPVDRADDHRKEKEEQIDRDVAEITTLFNKIDANALRELAEKNGGTWRMEQV |
Length | 145 |
Position | Head |
Organism | Fusarium oxysporum f. sp. cubense (strain race 1) (Panama disease fungus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium> Fusarium oxysporum species complex. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.842 |
Instability index | 18.52 |
Isoelectric point | 5.17 |
Molecular weight | 16852.83 |
Publications | PubMed=24743270 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31911 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.39| 21| 27| 24| 45| 1 --------------------------------------------------------------------------- 24- 45 (35.70/27.20) YRDlMNCVTVNGMDKEKQGD..YE 53- 75 (33.70/20.93) YRD.PDTMAAAGLRTQRKFDelYE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DYEAQANKLNYRDP 2) IKELL | 43 77 | 56 81 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab