<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31911
| Description |
Uncharacterized protein |
| Sequence | MDTSTPTNLMDKHQKIISEILRSYRDLMNCVTVNGMDKEKQGDYEAQANKLNYRDPDTMAAAGLRTQRKFDELYESIKELLALTRTIKELWVFGPVDRADDHRKEKEEQIDRDVAEITTLFNKIDANALRELAEKNGGTWRMEQV |
| Length | 145 |
| Position | Head |
| Organism | Fusarium oxysporum f. sp. cubense (strain race 1) (Panama disease fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium oxysporum species complex.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.842 |
| Instability index | 18.52 |
| Isoelectric point | 5.17 |
| Molecular weight | 16852.83 |
| Publications | PubMed=24743270
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31911
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.39| 21| 27| 24| 45| 1
---------------------------------------------------------------------------
24- 45 (35.70/27.20) YRDlMNCVTVNGMDKEKQGD..YE
53- 75 (33.70/20.93) YRD.PDTMAAAGLRTQRKFDelYE
---------------------------------------------------------------------------
|