<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31883
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSNSDSERSPKRQRLNSYSPASTGYPSPKRQRAEQPFIQTPPPSVRMSPSWQSQSQHIPHQSGGSNFPSPPSTAGYQNRMAEGGGDSGRQTPASQDDGELRRDGDGDAVMRDQREGTAADINMTDPEHRRSDHERLGGSTDVDPLPRFKVFAAPIPPSRPHPSQDLIELYGLKCIQANVRRRDPVTGAKINTMRKSYANKLKTLGLEGRNKAVPNQGELSGLLDPGWSQEVQPGSGVTLWDNNWSERGKLGDSNAEADVISKLDAALKMEPGQLPSKERESWNNVLGLDDFSVPSKGSAAATAKTPLASNPALAKTSAAHAMSSSAPASPRNQIRPDRKGKKRSYDDSSFEGYNQGYEDDGYSTGGLDDTGRRRDSSKRQKRKDIPSQANSPAFNPPGAVGVRSS |
| Length | 405 |
| Position | Head |
| Organism | Pseudocercospora fijiensis (strain CIRAD86) (Black leaf streak disease fungus) (Mycosphaerella fijiensis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Pseudocercospora.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.068 |
| Instability index | 69.28 |
| Isoelectric point | 9.31 |
| Molecular weight | 43873.63 |
| Publications | PubMed=23236275
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31883
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.09| 14| 16| 213| 228| 1
---------------------------------------------------------------------------
213- 228 (19.66/19.66) V.PNQGeLSgLLDPGWS
231- 245 (25.43/13.93) VqPGSG.VT.LWDNNWS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.09| 17| 20| 9| 27| 2
---------------------------------------------------------------------------
10- 26 (31.66/13.24) PKRQR.....LNSYSPASTGYP
28- 49 (26.43/ 8.20) PKRQRaeqpfIQTPPPSVRMSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.15| 15| 18| 112| 129| 3
---------------------------------------------------------------------------
112- 129 (23.55/21.19) D.QREGTAADInmtDPEHR
132- 147 (23.60/12.35) DhERLGGSTDV...DPLPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 122.34| 38| 78| 287| 324| 4
---------------------------------------------------------------------------
287- 324 (63.60/32.22) GLDDFSVPSKGSAAATAK.TP.LASNPALAKTSAAHAMSS
366- 405 (58.74/29.24) GLDDTGRRRDSSKRQKRKdIPsQANSPAFNPPGAVGVRSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.47| 11| 21| 246| 256| 6
---------------------------------------------------------------------------
246- 256 (18.61/10.93) ERGKLGDSNAE
270- 280 (19.86/12.18) EPGQLPSKERE
---------------------------------------------------------------------------
|