Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSNSDSERSPKRQRLNSYSPASTGYPSPKRQRAEQPFIQTPPPSVRMSPSWQSQSQHIPHQSGGSNFPSPPSTAGYQNRMAEGGGDSGRQTPASQDDGELRRDGDGDAVMRDQREGTAADINMTDPEHRRSDHERLGGSTDVDPLPRFKVFAAPIPPSRPHPSQDLIELYGLKCIQANVRRRDPVTGAKINTMRKSYANKLKTLGLEGRNKAVPNQGELSGLLDPGWSQEVQPGSGVTLWDNNWSERGKLGDSNAEADVISKLDAALKMEPGQLPSKERESWNNVLGLDDFSVPSKGSAAATAKTPLASNPALAKTSAAHAMSSSAPASPRNQIRPDRKGKKRSYDDSSFEGYNQGYEDDGYSTGGLDDTGRRRDSSKRQKRKDIPSQANSPAFNPPGAVGVRSS |
Length | 405 |
Position | Head |
Organism | Pseudocercospora fijiensis (strain CIRAD86) (Black leaf streak disease fungus) (Mycosphaerella fijiensis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Pseudocercospora. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.068 |
Instability index | 69.28 |
Isoelectric point | 9.31 |
Molecular weight | 43873.63 |
Publications | PubMed=23236275 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31883 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 45.09| 14| 16| 213| 228| 1 --------------------------------------------------------------------------- 213- 228 (19.66/19.66) V.PNQGeLSgLLDPGWS 231- 245 (25.43/13.93) VqPGSG.VT.LWDNNWS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.09| 17| 20| 9| 27| 2 --------------------------------------------------------------------------- 10- 26 (31.66/13.24) PKRQR.....LNSYSPASTGYP 28- 49 (26.43/ 8.20) PKRQRaeqpfIQTPPPSVRMSP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 47.15| 15| 18| 112| 129| 3 --------------------------------------------------------------------------- 112- 129 (23.55/21.19) D.QREGTAADInmtDPEHR 132- 147 (23.60/12.35) DhERLGGSTDV...DPLPR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 122.34| 38| 78| 287| 324| 4 --------------------------------------------------------------------------- 287- 324 (63.60/32.22) GLDDFSVPSKGSAAATAK.TP.LASNPALAKTSAAHAMSS 366- 405 (58.74/29.24) GLDDTGRRRDSSKRQKRKdIPsQANSPAFNPPGAVGVRSS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 38.47| 11| 21| 246| 256| 6 --------------------------------------------------------------------------- 246- 256 (18.61/10.93) ERGKLGDSNAE 270- 280 (19.86/12.18) EPGQLPSKERE --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PLPRFKVFAAPI 2) YSPASTGYPSPKRQRAEQPFIQTP | 144 18 | 155 41 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab