<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31880
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MPDATLDTIGEQLSNIIDNLYVLIVQAHDHHGQATSLDMITEIKRLVSNLQAITQTSKSLPTHLPIEIIQYVENGRNPDIYTREFVELVMRYNQQQKGRSEAFAAFRDILGREIMSGIPEIRDDVKQVVIATGGNLNQAAALG |
Length | 143 |
Position | Middle |
Organism | Dothistroma septosporum (strain NZE10 / CBS 128990) (Red band needle blight fungus) (Mycosphaerella pini) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Dothistroma.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.193 |
Instability index | 37.16 |
Isoelectric point | 5.09 |
Molecular weight | 15941.92 |
Publications | PubMed=23209441
PubMed=23236275
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP31880
No repeats found
No repeats found
|