<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31877

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMDSTAIDGPLTADAGMMDTTMDDLFGDAADGLGADLTGDLTGDLSGSLDAGLDGTLNVTLPHAPLPTESVLRIAEMRSRGCCSKLAWANTGSIARISEDGSRVTFHAMIRNATAASWKLSDENKHVINAPEGRKFVHIQFSGLGMDLAIVDHVGGLHMYTLLGALGRMGTAPGDYQRAVGPLTELNAIVGLHFLPLFPTELRGPYVDPAVKNGDKWQVTMRNRDQPNLRAHHPAEGKHALLHITRSGVFTLLYQNEGLGWQSTSTLLESIRSSNDLISHADIADDGADLLAITFDNASRFRLYRISISWNAAQQTRGPNLNYTVVAPTLEVHHLTASDHVHVQRADSAKLTHLRIVPIVHEAAQLGPTLPTIIVIFTHVGLPTDTNGAQQSFSIVSRWHIETLTPTLHESFQKLRPGADATSILNPVTVLRRQADVVLDKVVLCFASIIYDTIFAFGTSDGCLDLRDRQSMAELHFSGDTGTVSGLPQAGFAHLSSAQNIHVAMSADGAALALFRPGGKLVGQRMSFTHGWRALNDNGKPFVEAAAACVAREFTLLSLQNVSNDEALSLLPQDVTPDLRAMVVKMTLRFVSRPPVDAVDPMTKQQMFILREPLVPRSLSAQLAMGTNPRTGARDAGAQFAFVMLSLRVIAATLMQTLMKPDPRVQTPETLVSLHGIILWFTNLMIWIVQTLDQVRRASRHGTTPIQAFNQLRDSDDNVGLHILLCTFTRVAIRFSLPLVQKYFHFLQGVREHARTVSDRQQINAGLKMASSIPFKYHDFEKFILELDQAIRDALAKSISTPEHRADLEIAMMVDGTVPTELEPALSTLLGIALPKLTDNTNMSKLYFWQTESLGIKSNRPVAGMHIDVIRKLPIAQDAALRHCRRCGSAMMDIPQEKQREMPPWLLHAQRHCICMNYWLLL
Length921
PositionTail
OrganismDothistroma septosporum (strain NZE10 / CBS 128990) (Red band needle blight fungus) (Mycosphaerella pini)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Dothistroma.
Aromaticity0.06
Grand average of hydropathy-0.037
Instability index35.37
Isoelectric point6.53
Molecular weight101157.99
Publications
PubMed=23209441
PubMed=23236275

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364149
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP31877
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.23|      17|      23|      63|      85|       1
---------------------------------------------------------------------------
   63-   79 (30.11/30.97)	APLPTESVLRIAEMRSR
   86-  102 (31.12/14.43)	AWANTGSIARISEDGSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.24|      22|      22|     809|     830|       2
---------------------------------------------------------------------------
  790-  816 (30.18/16.85)	IRDALAKSISTpehraDLEIAM..MVDGT
  817-  840 (31.06/17.54)	VPTELEPALST.....LLGIALpkLTDNT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      83.02|      20|      22|     373|     392|       3
---------------------------------------------------------------------------
  350-  367 (17.07/ 6.61)	...LTHLRIvPIVHEAAQLGP
  373-  392 (35.29/21.51)	IVIFTHVGL.PTDTNGAQQSF
  394-  411 (30.66/17.73)	IVSRWHI...ETLTPTLHESF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      75.47|      17|      23|     140|     156|       4
---------------------------------------------------------------------------
   31-   44 (20.60/ 9.70)	..GLG.ADLT.GDL...TGDL
  140-  156 (32.14/19.55)	FSGLG.MDLAIVDH...VGGL
  162-  182 (22.74/11.52)	LGALGrMGTAPGDYqraVGPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.58|      12|      23|     664|     675|       5
---------------------------------------------------------------------------
  664-  675 (21.77/16.07)	VQTPETL..VSLHG
  688-  701 (16.81/10.51)	VQTLDQVrrASRHG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      97.10|      25|      26|     859|     883|       6
---------------------------------------------------------------------------
  844-  868 (29.69/16.34)	..KLYFWQTESLgiKSNRPVAGMHIDV
  869-  893 (45.37/28.88)	IRKLPIAQDAAL..RHCRRCGSAMMDI
  898-  912 (22.05/10.23)	QREMPPWLLHAQ..RHC..........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      33.66|       9|      33|     735|     745|       7
---------------------------------------------------------------------------
  735-  745 (14.12/16.26)	SLPLvqKYFHF
  771-  779 (19.54/13.34)	SIPF..KYHDF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.38|      32|      33|     597|     629|       8
---------------------------------------------------------------------------
  597-  629 (51.12/36.13)	AVDPMTKQQMFILREPLVPRSLSAQLaMGTNPR
  632-  663 (53.26/33.27)	ARDAGAQFAFVMLSLRVIAATLMQTL.MKPDPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      28.23|      10|     280|     430|     448|       9
---------------------------------------------------------------------------
  414-  423 (18.41/ 8.91)	LRPGADA.........TSI
  430-  448 ( 9.82/22.47)	LRRQADVvldkvvlcfASI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.16|      23|      27|     457|     481|      12
---------------------------------------------------------------------------
  457-  481 (33.68/33.48)	GTSD.GCLDLRDRQSMaELHFSGDtG
  485-  508 (36.47/24.99)	GLPQaGFAHLSSAQNI.HVAMSAD.G
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31877 with Med16 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




NANANA









Molecular Recognition Features






MoRF SequenceStartStop




NANANA