<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31877

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMDSTAIDGPLTADAGMMDTTMDDLFGDAADGLGADLTGDLTGDLSGSLDAGLDGTLNVTLPHAPLPTESVLRIAEMRSRGCCSKLAWANTGSIARISEDGSRVTFHAMIRNATAASWKLSDENKHVINAPEGRKFVHIQFSGLGMDLAIVDHVGGLHMYTLLGALGRMGTAPGDYQRAVGPLTELNAIVGLHFLPLFPTELRGPYVDPAVKNGDKWQVTMRNRDQPNLRAHHPAEGKHALLHITRSGVFTLLYQNEGLGWQSTSTLLESIRSSNDLISHADIADDGADLLAITFDNASRFRLYRISISWNAAQQTRGPNLNYTVVAPTLEVHHLTASDHVHVQRADSAKLTHLRIVPIVHEAAQLGPTLPTIIVIFTHVGLPTDTNGAQQSFSIVSRWHIETLTPTLHESFQKLRPGADATSILNPVTVLRRQADVVLDKVVLCFASIIYDTIFAFGTSDGCLDLRDRQSMAELHFSGDTGTVSGLPQAGFAHLSSAQNIHVAMSADGAALALFRPGGKLVGQRMSFTHGWRALNDNGKPFVEAAAACVAREFTLLSLQNVSNDEALSLLPQDVTPDLRAMVVKMTLRFVSRPPVDAVDPMTKQQMFILREPLVPRSLSAQLAMGTNPRTGARDAGAQFAFVMLSLRVIAATLMQTLMKPDPRVQTPETLVSLHGIILWFTNLMIWIVQTLDQVRRASRHGTTPIQAFNQLRDSDDNVGLHILLCTFTRVAIRFSLPLVQKYFHFLQGVREHARTVSDRQQINAGLKMASSIPFKYHDFEKFILELDQAIRDALAKSISTPEHRADLEIAMMVDGTVPTELEPALSTLLGIALPKLTDNTNMSKLYFWQTESLGIKSNRPVAGMHIDVIRKLPIAQDAALRHCRRCGSAMMDIPQEKQREMPPWLLHAQRHCICMNYWLLL
Length921
PositionTail
OrganismDothistroma septosporum (strain NZE10 / CBS 128990) (Red band needle blight fungus) (Mycosphaerella pini)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Dothistroma.
Aromaticity0.06
Grand average of hydropathy-0.037
Instability index35.37
Isoelectric point6.53
Molecular weight101157.99
Publications
PubMed=23209441
PubMed=23236275

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP31877
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.23|      17|      23|      63|      85|       1
---------------------------------------------------------------------------
   63-   79 (30.11/30.97)	APLPTESVLRIAEMRSR
   86-  102 (31.12/14.43)	AWANTGSIARISEDGSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.24|      22|      22|     809|     830|       2
---------------------------------------------------------------------------
  790-  816 (30.18/16.85)	IRDALAKSISTpehraDLEIAM..MVDGT
  817-  840 (31.06/17.54)	VPTELEPALST.....LLGIALpkLTDNT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      83.02|      20|      22|     373|     392|       3
---------------------------------------------------------------------------
  350-  367 (17.07/ 6.61)	...LTHLRIvPIVHEAAQLGP
  373-  392 (35.29/21.51)	IVIFTHVGL.PTDTNGAQQSF
  394-  411 (30.66/17.73)	IVSRWHI...ETLTPTLHESF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      75.47|      17|      23|     140|     156|       4
---------------------------------------------------------------------------
   31-   44 (20.60/ 9.70)	..GLG.ADLT.GDL...TGDL
  140-  156 (32.14/19.55)	FSGLG.MDLAIVDH...VGGL
  162-  182 (22.74/11.52)	LGALGrMGTAPGDYqraVGPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.58|      12|      23|     664|     675|       5
---------------------------------------------------------------------------
  664-  675 (21.77/16.07)	VQTPETL..VSLHG
  688-  701 (16.81/10.51)	VQTLDQVrrASRHG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      97.10|      25|      26|     859|     883|       6
---------------------------------------------------------------------------
  844-  868 (29.69/16.34)	..KLYFWQTESLgiKSNRPVAGMHIDV
  869-  893 (45.37/28.88)	IRKLPIAQDAAL..RHCRRCGSAMMDI
  898-  912 (22.05/10.23)	QREMPPWLLHAQ..RHC..........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      33.66|       9|      33|     735|     745|       7
---------------------------------------------------------------------------
  735-  745 (14.12/16.26)	SLPLvqKYFHF
  771-  779 (19.54/13.34)	SIPF..KYHDF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.38|      32|      33|     597|     629|       8
---------------------------------------------------------------------------
  597-  629 (51.12/36.13)	AVDPMTKQQMFILREPLVPRSLSAQLaMGTNPR
  632-  663 (53.26/33.27)	ARDAGAQFAFVMLSLRVIAATLMQTL.MKPDPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      28.23|      10|     280|     430|     448|       9
---------------------------------------------------------------------------
  414-  423 (18.41/ 8.91)	LRPGADA.........TSI
  430-  448 ( 9.82/22.47)	LRRQADVvldkvvlcfASI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.16|      23|      27|     457|     481|      12
---------------------------------------------------------------------------
  457-  481 (33.68/33.48)	GTSD.GCLDLRDRQSMaELHFSGDtG
  485-  508 (36.47/24.99)	GLPQaGFAHLSSAQNI.HVAMSAD.G
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP31877 with Med16 domain of Kingdom Fungi
Unable to open file!