<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31877
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MDSTAIDGPLTADAGMMDTTMDDLFGDAADGLGADLTGDLTGDLSGSLDAGLDGTLNVTLPHAPLPTESVLRIAEMRSRGCCSKLAWANTGSIARISEDGSRVTFHAMIRNATAASWKLSDENKHVINAPEGRKFVHIQFSGLGMDLAIVDHVGGLHMYTLLGALGRMGTAPGDYQRAVGPLTELNAIVGLHFLPLFPTELRGPYVDPAVKNGDKWQVTMRNRDQPNLRAHHPAEGKHALLHITRSGVFTLLYQNEGLGWQSTSTLLESIRSSNDLISHADIADDGADLLAITFDNASRFRLYRISISWNAAQQTRGPNLNYTVVAPTLEVHHLTASDHVHVQRADSAKLTHLRIVPIVHEAAQLGPTLPTIIVIFTHVGLPTDTNGAQQSFSIVSRWHIETLTPTLHESFQKLRPGADATSILNPVTVLRRQADVVLDKVVLCFASIIYDTIFAFGTSDGCLDLRDRQSMAELHFSGDTGTVSGLPQAGFAHLSSAQNIHVAMSADGAALALFRPGGKLVGQRMSFTHGWRALNDNGKPFVEAAAACVAREFTLLSLQNVSNDEALSLLPQDVTPDLRAMVVKMTLRFVSRPPVDAVDPMTKQQMFILREPLVPRSLSAQLAMGTNPRTGARDAGAQFAFVMLSLRVIAATLMQTLMKPDPRVQTPETLVSLHGIILWFTNLMIWIVQTLDQVRRASRHGTTPIQAFNQLRDSDDNVGLHILLCTFTRVAIRFSLPLVQKYFHFLQGVREHARTVSDRQQINAGLKMASSIPFKYHDFEKFILELDQAIRDALAKSISTPEHRADLEIAMMVDGTVPTELEPALSTLLGIALPKLTDNTNMSKLYFWQTESLGIKSNRPVAGMHIDVIRKLPIAQDAALRHCRRCGSAMMDIPQEKQREMPPWLLHAQRHCICMNYWLLL |
| Length | 921 |
| Position | Tail |
| Organism | Dothistroma septosporum (strain NZE10 / CBS 128990) (Red band needle blight fungus) (Mycosphaerella pini) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Dothistroma.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.037 |
| Instability index | 35.37 |
| Isoelectric point | 6.53 |
| Molecular weight | 101157.99 |
| Publications | PubMed=23209441
PubMed=23236275
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31877
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.23| 17| 23| 63| 85| 1
---------------------------------------------------------------------------
63- 79 (30.11/30.97) APLPTESVLRIAEMRSR
86- 102 (31.12/14.43) AWANTGSIARISEDGSR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.24| 22| 22| 809| 830| 2
---------------------------------------------------------------------------
790- 816 (30.18/16.85) IRDALAKSISTpehraDLEIAM..MVDGT
817- 840 (31.06/17.54) VPTELEPALST.....LLGIALpkLTDNT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 83.02| 20| 22| 373| 392| 3
---------------------------------------------------------------------------
350- 367 (17.07/ 6.61) ...LTHLRIvPIVHEAAQLGP
373- 392 (35.29/21.51) IVIFTHVGL.PTDTNGAQQSF
394- 411 (30.66/17.73) IVSRWHI...ETLTPTLHESF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 75.47| 17| 23| 140| 156| 4
---------------------------------------------------------------------------
31- 44 (20.60/ 9.70) ..GLG.ADLT.GDL...TGDL
140- 156 (32.14/19.55) FSGLG.MDLAIVDH...VGGL
162- 182 (22.74/11.52) LGALGrMGTAPGDYqraVGPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.58| 12| 23| 664| 675| 5
---------------------------------------------------------------------------
664- 675 (21.77/16.07) VQTPETL..VSLHG
688- 701 (16.81/10.51) VQTLDQVrrASRHG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 97.10| 25| 26| 859| 883| 6
---------------------------------------------------------------------------
844- 868 (29.69/16.34) ..KLYFWQTESLgiKSNRPVAGMHIDV
869- 893 (45.37/28.88) IRKLPIAQDAAL..RHCRRCGSAMMDI
898- 912 (22.05/10.23) QREMPPWLLHAQ..RHC..........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.66| 9| 33| 735| 745| 7
---------------------------------------------------------------------------
735- 745 (14.12/16.26) SLPLvqKYFHF
771- 779 (19.54/13.34) SIPF..KYHDF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 104.38| 32| 33| 597| 629| 8
---------------------------------------------------------------------------
597- 629 (51.12/36.13) AVDPMTKQQMFILREPLVPRSLSAQLaMGTNPR
632- 663 (53.26/33.27) ARDAGAQFAFVMLSLRVIAATLMQTL.MKPDPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 28.23| 10| 280| 430| 448| 9
---------------------------------------------------------------------------
414- 423 (18.41/ 8.91) LRPGADA.........TSI
430- 448 ( 9.82/22.47) LRRQADVvldkvvlcfASI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.16| 23| 27| 457| 481| 12
---------------------------------------------------------------------------
457- 481 (33.68/33.48) GTSD.GCLDLRDRQSMaELHFSGDtG
485- 508 (36.47/24.99) GLPQaGFAHLSSAQNI.HVAMSAD.G
---------------------------------------------------------------------------
|