<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31876
| Description |
Uncharacterized protein |
| Sequence | MSSAADSLTQLQDCVDTMLTMMYANLKYIQDRAPYSEIEGQPSQAPQGPITSVDTTMNGDGTAFAQNGNNDSATPVPEGPNKFTHELEDRAKDLVLQQKAMEYIIERLPGLGTSEAEQEKRMRELQVELRQLEQERALKELEKDAMVDLLGEAIGKIQRIP |
| Length | 161 |
| Position | Middle |
| Organism | Dothistroma septosporum (strain NZE10 / CBS 128990) (Red band needle blight fungus) (Mycosphaerella pini) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Dothistroma.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.652 |
| Instability index | 47.23 |
| Isoelectric point | 4.50 |
| Molecular weight | 17926.96 |
| Publications | PubMed=23209441
PubMed=23236275
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31876
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.16| 10| 14| 117| 126| 1
---------------------------------------------------------------------------
117- 126 (17.82/11.44) EQEKRMRELQ
133- 142 (16.34/ 9.99) EQERALKELE
---------------------------------------------------------------------------
|