Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MQQAGNDMHTYNLSLNRQALEENLRRRPGLEYMIVGQPQPHPDPALAAQGVTTGVYTIRKQDRQRAPPDVYLRPPHVLTEKSHDGKGSWELTVLGTYFAVGEAIYQAPSVFDIVGNRLLSAASSLNKFYNIADGLPRYTPATGYHYLPRSSKPVATATSATGTPARSREGSLAPATDSQSMRSGSVRPESQAGITSAAATLLETSLLAKSLEDSIRYGDEYTDENPLLGAPGTFYFQSSNTEVRKRREKEAAALKARLEQHTAMSSHTVVSTAEETVKIQSPPAVFTQERALKAEKSNGDRKGSKSSKKDRRKSRPATSPTTPASATSPQVPMSTA |
Length | 336 |
Position | Head |
Organism | Dothistroma septosporum (strain NZE10 / CBS 128990) (Red band needle blight fungus) (Mycosphaerella pini) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Dothistroma. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.662 |
Instability index | 60.60 |
Isoelectric point | 9.55 |
Molecular weight | 36433.27 |
Publications | PubMed=23209441 PubMed=23236275 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31875 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 344.96| 91| 107| 5| 96| 1 --------------------------------------------------------------------------- 5- 96 (155.14/80.74) GNDMHTYNLSLNR.QALEENL.RRRPGLEYMIVgQPQPHPDPALAAQGV.TTGVYTIRKQDRQRAP.PDVY.LRPPHVLTEKSH.DGKGSWELTVLGT 115- 204 (117.62/56.97) GNRLLSAASSLNKfYNIADGLpRYTPATGYHYL....PRSSKPVATATS.ATGT.PARSREGSLAPaTDSQsMRSGSVRPE.SQ.AGITSAAATLLET 237- 304 (72.20/32.51) ..............QSSNTEV.RKRREKEAAAL.KARLEQHTAMSSHTVvSTAEETVKIQ....SP.PAVF.TQERALKAEKSNgDRKGS........ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) KSSKKDRRK 2) LEYMIV 3) LKAEK 4) TGYHYLPR | 305 30 292 142 | 313 35 296 149 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab