Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MALPQESQRAIDNLRTRLSMLSNSLGAMQREFNESNPLPTWPRLQSQAVTLGNNLQEIADVLNSQHQLFSTMHAYPVPSFPGTTQEPVLQGLLRKKLDPRAEEWIDEALKEEKVSAIQNGDKGGAQILSMKQMQDLWESAGPTFQEILQPLMEDGILEDEYTIQEREDGIQNVVTGIRRKLYGPLDDDDEDEDEDMEIDEPEEQVIVNQPGFEAGVPYVRLDDLLKFAVTGSQPAPPR |
Length | 238 |
Position | Head |
Organism | Dothistroma septosporum (strain NZE10 / CBS 128990) (Red band needle blight fungus) (Mycosphaerella pini) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Dothistroma. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.646 |
Instability index | 54.66 |
Isoelectric point | 4.28 |
Molecular weight | 26813.62 |
Publications | PubMed=23209441 PubMed=23236275 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31874 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 104.18| 26| 33| 150| 182| 1 --------------------------------------------------------------------------- 150- 175 (45.73/20.54) PLMEDGILEDE.YTIQEREDGIQNVVT 184- 205 (24.98/17.26) PLDDDDEDEDEdMEIDEPEEQV..... 210- 230 (33.48/12.06) PGFEAGV...P.YV..RLDDLLKFAVT --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 118.28| 36| 36| 14| 49| 2 --------------------------------------------------------------------------- 14- 49 (61.06/35.43) LRTRLSMLSNSLGAMQREFN..ESNPLPTWPRLQSQAV 51- 88 (57.21/32.81) LGNNLQEIADVLNSQHQLFStmHAYPVPSFPGTTQEPV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PEEQVIVNQPGFEAGVPYVRLDDLLKFAVTGSQP 2) VVTGIRRKLYGPL | 201 173 | 234 185 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab