<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31859
| Description |
Cyclin-dependent protein kinase Ssn3 |
| Sequence | MDRYKVIGFISSGTYGRVYKAHGRQGQPGEFAIKKFKPDKEGEQVQYTGISQSAIREMALCSELSHQNIIKLVEIILEDKCIYMVFEYAEHDLLQIIHHHTQPIRHPIPPSTVKSIMFQLLNGSHYLHVNWVLHRDLKPANIMVTIGGEVKIGDLGLARLFNKPLHSLFSGDKVVVTIWYRAPELLLGSRHYTPAVDMWAIGCIFAELLSLRPIFKGEEAKIDSKKTVPFQRNQMQKIVEIMGMPTKEKWPLLIKMPEYSNLATLSSGHSSKSGSLLEKWYYSTINSTQSSAASNVSLGVEGYKLLSGLLEYDPERRLTAQQALQHPFFSTGDKFSNNCFEGIKAEYPHRRVSQEDNDIRSCSLPGTKKVGPVDDSRPAKRLKE |
| Length | 384 |
| Position | Kinase |
| Organism | Blumeria graminis f. sp. hordei (strain DH14) (Barley powdery mildew) (Oidium monilioides f. sp. hordei) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Erysiphales> Erysiphaceae> Blumeria.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.337 |
| Instability index | 38.44 |
| Isoelectric point | 9.04 |
| Molecular weight | 43457.58 |
| Publications | PubMed=21148392
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP31859
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.36| 17| 29| 130| 146| 1
---------------------------------------------------------------------------
130- 146 (31.25/22.68) NWVLHRDLKPANIMVTI
162- 178 (29.11/20.66) NKPLHSLFSGDKVVVTI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.03| 28| 32| 248| 278| 2
---------------------------------------------------------------------------
248- 276 (45.66/29.83) EKWPL.LIKMPEYSNLATLS...SGHSSKSGsL
278- 309 (39.37/26.41) EKWYYsTINSTQSSAASNVSlgvEGYKLLSG.L
---------------------------------------------------------------------------
|