| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MSSHLNENSDSSQFVPFTKSERIQQLNDIDKSMNQLLKSAGLAIQTLSVKQPSPSLTTSERRQKFEENCNTYLCTLQIIDIGLHRQIYGLEQAGIIPADKTKKERSSTEAFMTASVANRSMERDSLQVEGGMGKFDIGLLNSQSGRILRDLEAELWEKARCLLEDLYQNSDSPGALEDVDMIK |
| Length | 183 |
| Position | Head |
| Organism | Blumeria graminis f. sp. hordei (strain DH14) (Barley powdery mildew) (Oidium monilioides f. sp. hordei) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Erysiphales> Erysiphaceae> Blumeria. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.546 |
| Instability index | 58.58 |
| Isoelectric point | 5.04 |
| Molecular weight | 20517.89 |
| Publications | PubMed=21148392 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP31855
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 136.96| 47| 54| 37| 83| 1
---------------------------------------------------------------------------
33- 82 (72.98/52.50) M...nqlLKSAGLAIQTLSVKQPSPS...LTTSERRQKFEENCNTYLCTLQIIDIG
83- 138 (63.98/45.22) LhrqiygLEQAGIIPADKTKKERSSTeafMTASVANRSMERDSLQVEGGMGKFDIG
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EAELWEKAR 2) VDMIK | 152 179 | 160 183 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab