<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31832
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MASLNQDQIKTLEQSRQRLVQLTRSLASLIGSLNQSDPLPSWSSLQSQAGIISNNLLSISEHLSDNKDLLSALVAYPGPSYPGRTQAPTLEQLLRTKLDPRVEDWVSRGRRAGASALEDRGALSESALAELWDWAPVEANQEARRRNWGGNFTLEEREMGIQNVVTGLRRQLEDEDEEESESESEEEGEGEEEEMEVVGVRRRSGAGAGLEFDIAAPTPGSRQQQQQKAAGPAVPLEDILRYMTTGIPPTQR |
| Length | 252 |
| Position | Head |
| Organism | Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) (Aspergillus fischerianus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus>
Aspergillus subgen. Fumigati.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.713 |
| Instability index | 72.89 |
| Isoelectric point | 4.61 |
| Molecular weight | 27803.33 |
| Publications | PubMed=18404212
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP31832
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.16| 22| 26| 84| 105| 2
---------------------------------------------------------------------------
84- 105 (38.72/22.17) RTQAPTLEQ..LLRTKLDPRVEDW
111- 134 (32.44/17.57) RAGASALEDrgALSESALAELWDW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 72.37| 17| 34| 155| 171| 3
---------------------------------------------------------------------------
155- 171 (30.44/15.04) EEREMGIQNVVTGLRRQ
191- 203 (22.64/ 9.86) EEEEME....VVGVRRR
211- 224 (19.28/ 7.63) ...EFDIAAPTPGSRQQ
---------------------------------------------------------------------------
|