<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31827
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MQRDEKLFELTLDTVLQRLNDLKLAVLSMIQKLELEYETINWPTFLDNFAIISSHLTGLTKILAKEQCPPLRNRTVLPLLVSMDRDDTLINITEGRVPVFSHDIVPDYLRTRPDPITEQKMLQNEQKAANLTNDAAMKQVTQYNKVVSHVLDMVSKAREEWEIESSSRTGIQQTSSMADTQLLVAAVGMGKGLKLTNYGPGPGMMVPPSIRAPSPMGGPAMSPGNVQQQLGKAPSAVKTNIKSANQVHPFSR |
| Length | 252 |
| Position | Head |
| Organism | Drosophila melanogaster (Fruit fly) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea>
Drosophilidae> Drosophila> Sophophora.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.306 |
| Instability index | 39.69 |
| Isoelectric point | 7.83 |
| Molecular weight | 27947.95 |
| Publications | PubMed=10731132
PubMed=12537572
PubMed=12537569
PubMed=16751183
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity). Required for
activated transcription of the MtnA and MtnB genes.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 ISS:FlyBase
|
| GO - Biological Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000978 IBA:GO_Central
transcription coregulator activity GO:0003712 IMP:UniProtKB
|
| GO - Biological Process | F:transcription coregulator activity GO:0003712 IMUniProtKB
regulation of transcription by RNA polymerase II GO:0006357 IMUniProtKB
|
Interaction
Repeat regions
| Repeats |
>MDP31827
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.35| 16| 18| 199| 214| 1
---------------------------------------------------------------------------
199- 214 (33.19/21.69) GP..GPGMMVPPSIRAPS
218- 235 (26.16/15.61) GPamSPGNVQQQLGKAPS
---------------------------------------------------------------------------
|