<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP31827

Description Mediator of RNA polymerase II transcription subunit 8
SequenceMQRDEKLFELTLDTVLQRLNDLKLAVLSMIQKLELEYETINWPTFLDNFAIISSHLTGLTKILAKEQCPPLRNRTVLPLLVSMDRDDTLINITEGRVPVFSHDIVPDYLRTRPDPITEQKMLQNEQKAANLTNDAAMKQVTQYNKVVSHVLDMVSKAREEWEIESSSRTGIQQTSSMADTQLLVAAVGMGKGLKLTNYGPGPGMMVPPSIRAPSPMGGPAMSPGNVQQQLGKAPSAVKTNIKSANQVHPFSR
Length252
PositionHead
OrganismDrosophila melanogaster (Fruit fly)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Brachycera> Muscomorpha> Ephydroidea> Drosophilidae> Drosophila> Sophophora.
Aromaticity0.04
Grand average of hydropathy-0.306
Instability index39.69
Isoelectric point7.83
Molecular weight27947.95
Publications
PubMed=10731132
PubMed=12537572
PubMed=12537569
PubMed=16751183

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). Required for activated transcription of the MtnA and MtnB genes.
ECO:0000250	
ECO:0000269	PubMed:16751183
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	ISS:FlyBase
GO - Biological Function
RNA polymerase II cis-regulatory region sequence-specific DNA binding	GO:0000978	IBA:GO_Central
transcription coregulator activity	GO:0003712	IMP:UniProtKB
GO - Biological Process
F:transcription coregulator activity	GO:0003712	IMUniProtKB
regulation of transcription by RNA polymerase II	GO:0006357	IMUniProtKB

Interaction

Binary Interactions
[A1ZBT5<-->Q9VP65: CG12975]	NbExp=3	EBI-90766,EBI-141782

Repeat regions

Repeats

>MDP31827
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.35|      16|      18|     199|     214|       1
---------------------------------------------------------------------------
  199-  214 (33.19/21.69)	GP..GPGMMVPPSIRAPS
  218-  235 (26.16/15.61)	GPamSPGNVQQQLGKAPS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP31827 with Med8 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) TNYGPGPGMMVPPSIRAPSPMGGPAMSPGNVQQQLGKAPSAVKTNIKSANQVHPFSR
196
252

Molecular Recognition Features

MoRF SequenceStartStop
NANANA