Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MASLNQDQIKILEQSRQRLVQLTRSLASLIGSLNQSDPLPSWSSLQSQAGIISNNLVSISEHLADNKDLLSALVAYPGPSYPGRTQAPTLEQLLRTKLDPRVEDWVSRGRRAGASALEDRGALSESALAELWDWAPVEANQEARRRNWGGNFTLEEREMGIQNVVTGLRRQLEDEDEEASESEEEVEEEEMEVVGVRRRSGAGAGLEFDIAAPAPGSRQQQQQQKAAGPAVPLEDILRYMTTGIPPTQR |
Length | 249 |
Position | Head |
Organism | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Fumigati. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.620 |
Instability index | 73.03 |
Isoelectric point | 4.70 |
Molecular weight | 27465.15 |
Publications | PubMed=16372009 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000978 IBA:GO_Central transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP31816 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 79.98| 25| 27| 80| 105| 1 --------------------------------------------------------------------------- 80- 105 (41.49/28.33) SYPGRTQAPTLEQ...LLRTKLdPRVEDW 107- 134 (38.49/21.52) SRGRRAGASALEDrgaLSESAL.AELWDW --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 35.15| 10| 34| 155| 164| 2 --------------------------------------------------------------------------- 155- 164 (18.07/12.15) EEREMGIQNV 187- 196 (17.08/11.14) EEEEMEVVGV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AGAGLEFDIAAPAPGSRQQQQQQKAAGPAVPLEDILRYMTTGIPPTQR 2) VVGVRRR | 202 193 | 249 199 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab