Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MASPSQDQIKVLEQSRQRLVQLTRSLGSLIGSLNQSDPLPSWSSLQSQASIISNNLLSVSEHLSDNCDLLSALVAYPGPEYPGRTQASTLEQLLRTKLDPRIEDWVARGRRAGASALEDKDALSETELAELWDWAPVEANQEARRRNWGGDYTLEEREMGIQNVVTGLRRQLEDDERDEDEDEDDEEEEEGEGEDEEMEVVGVRRRSDAGAGLGFDTAVPTPASSQQVQKGAGPVVPLDDVLRFMTTGTLPQQR |
Length | 254 |
Position | Head |
Organism | Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Fumigati. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.743 |
Instability index | 68.41 |
Isoelectric point | 4.30 |
Molecular weight | 28131.45 |
Publications | PubMed=18404212 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors (By similarity).
ECO:0000250 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP31815 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 71.74| 22| 26| 84| 105| 1 --------------------------------------------------------------------------- 84- 105 (38.46/24.02) RTQASTLE..QLLRTKLDPRIEDW 111- 134 (33.28/19.89) RAGASALEdkDALSETELAELWDW --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EEMEVVGVRRRSD 2) LDDVLRFMTTGTLP 3) RSLGSL | 196 238 24 | 208 251 29 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab